SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006644 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006644
Domain Number 1 Region: 552-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000425
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 1061-1111
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000641
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 3 Region: 484-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000037
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 1016-1069
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000472
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 5 Region: 609-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000152
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 6 Region: 247-271,450-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000849
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 7 Region: 636-691
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000503
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006644   Gene: ENSDORG00000007083   Transcript: ENSDORT00000007088
Sequence length 1330
Comment pep:novel scaffold:dipOrd1:scaffold_2842:65729:84077:-1 gene:ENSDORG00000007083 transcript:ENSDORT00000007088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEENEVESSSDATPRPGRPEEPSESLGVGTSEAVSADSSDSATALGPAEADDSGVGQSSD
SGSRSLEEVSESSSSTDPLPHGYLPDSSSVSQGTVAELPGGPTVLVHSSALPDPNMLVAD
CTASSSDLGSAIDKIIESTIGPDLIQSCITVTSAEDGGAETTRYLILQGPDDGAPMTSAM
STSSLAHSLAAIEALADGPTSTSTSLEPSEEAAAGSSSLPQPLPAPGAEELDLQSLEALM
EVVVVQQFKCKMCQYRSSTKATLLRHMRERHLRPVAAAASTAGKKGRMRKGDTAATKTPE
EEGPEEEEDDDIVDAGAIDDLEEDSDYNPAEDEPRGRQLRLQRPTPSTPRPRRRPGRPRK
LPRLETSDLLGGVGEPLVSSQSGQSPPDPEAPSSSGPGHLVAPDKASKSLVEPGVSQSDE
PDVPPRRRGRPSRRFLGKKYRKYYYKSPKPLLRPYLCRICGSRFLSHEDLRFHVNSHEAG
DPQLFKCLQCSYRSRRWSSLKEHMFNHVGSKPYKCDECSYTSVYRKDVIRHAAVHSRDRK
KRPDPTPKLSSFPCPVCGRVYPMQKRLTQHMKTHSTEKPHMCDKCGKSFKKRYTFKMHLL
THIQAVANRRFKCEFCEFVCEDKKALLNHQLSHVSDKPFKCSFCPYRTFREDFLLSHVAV
KHTGAKPFACEYCHFSTRHKKNLRLHIRCRHASSFEEWGRRHPEEPPSRRRPFFSLQQIE
ELKQQHSAAPGPPPSSPGPPEVPQEAAPFQSPETPPLLCSDPLGGATIIYQHGAEESTAM
ATRTALDLLLNMSAQRELGGTALQVAVVKSENTESASPGGQPSPEDPTPQVVTLHVAESG
GGMAAESQLGPSDLQQITLAPGPFGGAGYSVITAPPAEEGTSAPGTPFSEEPPGEAAQAV
VVSDTLKDTGTHYIMAADGTQLHHIELTADGSISFPSADALTSGAKWPLLQCGGLPRDGP
EPLSPAKTHQAGDTQGSASSPPAASKALGLVVPPSPPSAATAASKKFSCKICAEAFPGRA
EMESHKRAHAGPAAFKCPDCPFSARQWPEVRAHMAQHSSLRPHQCSQCSFASKNKKDLRR
HMLTHTNEKPFSCHLCGQRFNRNGHLKFHIQRLHSSDGRKSGTPAARAPAQTPTQTIILN
SDEETLATLHTALQSSHGVLGPERLQQALGQEHIIVAQEQTVANQEEATYIQEITTADGQ
TVQHLVTSDNQVQYIISQDGVQHLLPQEYVVVPDGHHIQVQEGQITHIQYEQGGPFLQES
QIQYVPVSPGQQLVTQAQLEAAAHSAVTAVADAAMAQAQGLFGTEEAVPEHIQQLQHQGI
EYDVITLTDD
Download sequence
Identical sequences ENSDORP00000006644 ENSDORP00000006644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]