SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006679 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006679
Domain Number 1 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-17
Family Classic zinc finger, C2H2 0.0013
Further Details:      
 
Domain Number 2 Region: 327-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000213
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 3 Region: 235-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000506
Family Classic zinc finger, C2H2 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006679   Gene: ENSDORG00000007124   Transcript: ENSDORT00000007124
Sequence length 1107
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3297:15726:26848:1 gene:ENSDORG00000007124 transcript:ENSDORT00000007124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNSMTPPPVSSYGEPCCLRPLPSQGVPSMGTEGPSGLPFCHQANLMPGPHGYGPARETN
NCIEGPLFPPPRNAVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGS
YGHLSIGTMSPSLGFPTQVNHQKGTSPSFGVQPCGPHDSTRSGMMPHPQTRGPLPTCQLK
SELDMLVNKCPEEPLEGDMSSPNSTGTQDHLLGLLDGREDLEREEKPEPESVYETDCRWD
GCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKP
HKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEK
PYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPTLSTAEPKREREG
GPIGGENRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNTGGSTEDLSS
LDEGPCIAGTGLSTLRRLENLRLDQLHQLRPLGPRGLKLPSLTHTGTPVSRRLGPPVSLD
HRSSSSSSMSSAYTVSRRSSLASPFPPGSPPENGTSSLPGLTPAQHYLLRARYSSARGGG
TPPTAAPSLDRMGGLPVPPWRSRAEYPGYNPNAGVTRRASDPARAADHPAPVRVQRFKSL
GCVHTPPIGATGGRNFDPHLPTSVYSPQPPSINENVAMDTRGLREEPEVSTSMMGSGLNP
YMDFSSADALGYGGPEGAAAEPYGARGPGSLPLGSGPPTNYGPSPCPQQVSYPDPTTDSW
GELPSHSGPYPGTKTPSGTYSHCPRLEHYGQVQVKPEQGCPVGSDSTALAACLNAHPSEG
SPCSQPPFSHYPQPPPPQYPQSGLYPQPSPDYLPSEPRLSLDFDSPSHSTGQLKAQLVCN
YVQSQQELLWEGGGRGEAPIPEPPYQSHKFLGGSQVTPSTTKAPLATYGPDFAPNLPNHK
AGSYPTSSPCHENFAVGTNRVSQHRAAAPPRLLPPLPTCYGPLKAGGTNPSCGHPDVGRL
GGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEAQGLSPPPSHDQEGSSEHTPPPSG
PPNMAVGNMSVLLGSLPGETQFLNSSA
Download sequence
Identical sequences A0A1S3FJX3
ENSDORP00000006679 ENSDORP00000006679 XP_012876615.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]