SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006695 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000006695
Domain Number - Region: 2-41
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0666
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006695   Gene: ENSDORG00000007139   Transcript: ENSDORT00000007140
Sequence length 476
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3416:77523:83875:1 gene:ENSDORG00000007139 transcript:ENSDORT00000007140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPPPVPRPGIPPMTQAQAVSAPGILNRPPA
PTATVPAPQPPVTKPLFPSAGQMGTPVTSSSTASSNSESLSASSKALFPSTAQAQAAVQG
PVGTDFKPLNNTPATTTEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSKPATLTTTS
ATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGM
RPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGPPMVPPYQGGPPRPPMGMRPPVMSQ
Download sequence
Identical sequences ENSDORP00000006695 ENSDORP00000006695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]