SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006726 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006726
Domain Number 1 Region: 7-119
Classification Level Classification E-value
Superfamily POZ domain 1.52e-26
Family BTB/POZ domain 0.00049
Further Details:      
 
Domain Number 2 Region: 358-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000381
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006726   Gene: ENSDORG00000007173   Transcript: ENSDORT00000007172
Sequence length 412
Comment pep:novel scaffold:dipOrd1:scaffold_24307:17430:18665:-1 gene:ENSDORG00000007173 transcript:ENSDORT00000007172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMRIKLQSTNHPNNLLKELNKCRLSETMCDVTIVVGSRSFPAHKAVLACAAGYFQNLFL
NTGLDAARTYVVDFITLANFEKILSFVYTSELFTDLINVGVIYEVAERLGMEDLLQACHF
TFPDLESTAVTQSLSSTSDSQYSSLTCPAADPTHPLGELRGGGEHLGPDRHYVLSADTGG
SYKEEERNVASDPNHHSQPLPQPPLPPKTEDHDAPAPFTSVPLMTQPGLGTVNAGIQTST
SSCQPYKVQSNGDFNKNSFFTPDNAIDITTGTNSCLSNSDHSKEPGFGQMDELQLEDLGD
DDLQFEDPTEEIGTAEEVIELSDDSEDELTFGENDNRENKAMPCQVCKKVLEPNIQLIRQ
HARDHVDLLTGNCKVCETHFQDRNSRVTHVLSHIGIFLFSCDMCETKFFTQW
Download sequence
Identical sequences ENSDORP00000006726 ENSDORP00000006726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]