SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006755 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006755
Domain Number 1 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 201-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.52e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.79e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 145-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.51e-22
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 107-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 355-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006755   Gene: ENSDORG00000007204   Transcript: ENSDORT00000007203
Sequence length 414
Comment pep:novel scaffold:dipOrd1:scaffold_16412:84:1328:1 gene:ENSDORG00000007204 transcript:ENSDORT00000007203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AETKALQLLVPKPEPYHEVENHPILPGRNQKAGPQGPELEEICENGTMLKRQRRKREKKD
FRKVTIQDYHFSGSFKEEEGQKHKKSKGNNSLSSGAVKNKKIQPGLKPFTCSVCGKSFSQ
SANLVVHQRIHTGEKPFECHACGKAFIQSANLVVHQRIHTGQKPYVCAKCGKAFTQSSNL
TVHQKIHSLEKTFKCSDCDKAFSYSSQLARHQKVHITEKCYECNECGKTFTRSSNLIVHQ
RIHTGEKPFACSDCGKAFTQSANLIVHQRSHTGEKPYECKECGKAFSCFSHLIVHQRIHT
AEKPYDCSECGKAFSQLSCLIVHQRIHSGDLPYVCGQCGKAFTCSSYLLIHQRIHNGEKP
YTCHECGKAFRQRSSLTVHQRTHTGEKPYECAKCGAAFISNSHLMRHHRTHLVE
Download sequence
Identical sequences ENSDORP00000006755 ENSDORP00000006755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]