SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006758 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006758
Domain Number 1 Region: 362-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000105
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 2 Region: 190-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000194
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 3 Region: 258-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000769
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 137-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000594
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006758
Domain Number - Region: 311-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000519
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006758   Gene: ENSDORG00000007205   Transcript: ENSDORT00000007206
Sequence length 448
Comment pep:novel scaffold:dipOrd1:scaffold_16412:10644:13207:1 gene:ENSDORG00000007205 transcript:ENSDORT00000007206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFNTKGDEIGSETYLTWKNHGDNSPRLPGRRCPKNEYDSLFEENHSRENTKEISLKEIAR
PCLFQEGGFEGITFILPSPPEMSSQESNRKSLILTSSIVTHLRVSTEKSPPEWEAGKVHS
NEILDQPCKAEEGNIIQSSPFTQHERTHTRGRPDACKCGQTFHHSSFHVQQERIHIGVKS
YLREQCREIFQCRSFLSQHQRPPNTGYQCNGYGKAFHQNTHLIHPQRIHTGDKPYSCNHC
GSAFGPQSNLTHQRIHTGAKHHTCSEYGKYFKIDSSQPQRIHTGEKAYRCKEHGQTFSQI
PSLTMHRIYPPYKCKGFGKAFVCRTPRTKLQRMRTDQRPYKCAFILFQHRCHTYGKCSNQ
NPYQPTRTHTAVWPSECEQCRKAFAHSSSFTKHHRTHTGEKLCTCSKCEKAFCKYALSEH
KQIHTEKPHKGLDDGSSVLSRLQKLHSG
Download sequence
Identical sequences ENSDORP00000006758 ENSDORP00000006758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]