SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006778 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006778
Domain Number 1 Region: 926-978
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 237-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000627
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 3 Region: 899-934
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000431
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 171-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000233
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 5 Region: 594-641
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000813
Family Homeodomain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006778   Gene: ENSDORG00000007230   Transcript: ENSDORT00000007230
Sequence length 1126
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3850:59254:216934:1 gene:ENSDORG00000007230 transcript:ENSDORT00000007230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITDAGDCEGGVPED
DLPTDQTVLPGSSEREGSAKNCWEDDXXXXXXXXXXXXXXXXXXXXXXKDDECDSDAENE
QNHDPNVEEFLQQQDTAVIYPEAPEEDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGY
KRFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGGNRK
FKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLMPVN
GRPRTGLKTSQCSSPSLSASPGSPTRPQIRQKIENKPLQEQLSVNQIKTEPVDYEFKPIV
VASGINCSTPIQNGVFSGGGPLQATSSPQGVVQAVVLPTVGLVSPISINLSDIQNVLKVA
VDGNVIRQVLENNQANLASKEQETINASSIQPGGHSVISAISLPLVDQDGTTKIIINYSL
EQPSQLQVVPQNLKKENPVPANSCKSEKLPEDLTVKTEKDKSFEGGVNDSTCLLCDDCPG
DLNALPELKHYDLKQPAQPPPLPAPEVEKPESSVSSGTGDGNLSPSQPPLKNLLSLLKAY
YALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNE
EQHQSTNADEPQDSTISLQSPLKMLNSPGLPVGSTVNGSRSSTPSPSPLNLSSARNTQGY
MYPAEGAQEEPQVEPLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNLSCAKKEPQK
DNCVTDSEPVVNVIPSANPINIAIPTVTAQLPTIVAITDQNSVPCLRALAANKQTILIPQ
VAYTYSTTVSPAIQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
NGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPY
QCDKCGKRFSHSGSYSQHMNHRYSYCKREAEERDSTEQEEAGPEVLMNEHAGARASPSQG
DSDERESLTREEDEDSEKEEEEEEDKEIEELQEEKECGKPQGDEEEEEEEEEMEEEEEVE
EAENERKEANTEGPMKDDGAVSQAGNLEQKVSKSTEQVSEEKTNEA
Download sequence
Identical sequences ENSDORP00000006778 ENSDORP00000006778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]