SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006810 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006810
Domain Number 1 Region: 578-689
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.57e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00032
Further Details:      
 
Domain Number 2 Region: 57-221
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.48e-27
Family G proteins 0.0000000506
Further Details:      
 
Domain Number 3 Region: 702-793
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.62e-16
Family Ankyrin repeat 0.0025
Further Details:      
 
Domain Number 4 Region: 321-386,518-561
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000278
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006810   Gene: ENSDORG00000007265   Transcript: ENSDORT00000007265
Sequence length 836
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2982:29652:42088:-1 gene:ENSDORG00000007265 transcript:ENSDORT00000007265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSTGGPPGSGPLHGPPGLSSGSGSRELLGAELRASPXXXXXXXXXXXXXXXXXXXXGVLG
DARSGKSSLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGWAD
AVIFVFSLEDENSFQAVSRLHGQLSALRGEGRGGLALALVGTQDRISASSPRVVGDARAR
ALCTDMKRCSYYETCATYGLNVDRVFQEVSQKVVTLRKQQQLLAACKSLPSSPSHSAAST
PVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANR
RGSDSEKRSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPS
INDYIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGLVKDMSTVQMGEGPEVTT
PMPSPSPSPGSLQPPDQTSKHLLKPDRNLARALSTDCTPSGDSPMSREPQSPMVKKQRRK
KLTTPSKTEDSAVQAEAKRKMWKLKSFGSLRNIYKAEENFEFLIVSSTGQTWHFEAASFE
ERDAWVQAIESQILASLQCCESSKVKLRTDSQSEAVAIQAIRNAKGNSICVDCGAPNPTW
ASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTLVLTAIGNDTANRIWESDTR
GRAKPTRDSSREERESWIRAKYEQLLFLAPLGTTEEPLGLQLWAAVQAQDVAAVLLLLAH
ARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQGRTALFYARQAGS
QLCADILLQHGCPGEGGSAATTPSAATTPSMTATPSPRRRSSAASVGRVEAPVALV
Download sequence
Identical sequences ENSDORP00000006810 ENSDORP00000006810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]