SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006936 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006936
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.8e-23
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 2 Region: 168-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000648
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 3 Region: 129-166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000768
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 4 Region: 333-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000329
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006936
Domain Number - Region: 209-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00335
Family Classic zinc finger, C2H2 0.048
Further Details:      
 
Domain Number - Region: 69-114
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0111
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006936   Gene: ENSDORG00000007394   Transcript: ENSDORT00000007394
Sequence length 364
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_147:5325:8789:1 gene:ENSDORG00000007394 transcript:ENSDORT00000007394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMVTFRDVAVDFSLDEWGWLSPAQRNLYRTVVLENYQNLLSVGVCISKPYVISLLEQGKE
PWETSTMTRSLLADKKTHSKEKSYGCEYREIFRDSLLLANHTRKYYTTGKIECNKFKALN
LTKHSPILEKNCYCNDCGKIFSTLSYLNRHKRSTKEKFTRCSHCRKLSTSLIVSPRIHTG
EKPCKCDQCGKTFIRVSSNITVHQKTHSGKKRHICTHCKVFRNVQVSKNRAIHTGKASCK
QHEQAFQCESSLNFHRKIHRRTTQYESKGCGSVRLVTQRQKIYPTEKKPSKCSEWYKEFN
QIDHSQHCRQCGRTPYHPSEHGETQSGTFCLKWHGRHHTGEKPFKRNQGGKAFMGNSYLI
PHRR
Download sequence
Identical sequences ENSDORP00000006936 ENSDORP00000006936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]