SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006975 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006975
Domain Number 1 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.99e-26
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 176-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 344-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.22e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 400-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 288-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.83e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 7-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-21
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 7 Region: 123-176
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 447-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000511
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006975   Gene: ENSDORG00000007438   Transcript: ENSDORT00000007436
Sequence length 471
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6499:62022:65739:-1 gene:ENSDORG00000007438 transcript:ENSDORT00000007436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATLLMAGSQAPVTFEDMAMYLTREEWRPLDPTQRDLYRDVMQENYGNVVSLDFEIRSE
NEVNPKQEISEEVEFGTTSDGRPVGSREENPEGEEAFDSGDRPERQWGDLTAEEWVSYPL
QQVTDLLVHKEVHPGIQYHICSHCGKAFSQISDLNRHQKTHTGDRPYKCYECGKGFSRSS
HLIQHQRTHTGERPYDCNECGKSFGRSSHLIQHQTIHTGEKPHKCNECGKSFCRLSHLIQ
HQRTHSGEKPYECEECGKSFSRSSHLAQHQRTHTGEKPYECNECGRGFSERSDLIKHYRV
HTGERPYKCDECGKNFSQNSDLVRHRRAHTGEKPYHCNECGENFSRISHLVQHQRTHTGE
KPYECNACGKSFSRSSHLITHQKIHTGEKPYECNECWRSFGERSDLIKHQRTHTGEKPYE
CVQCGKGFTQSSNLITHQRVHTGEKPYECTECEKSFSRSSALIKHKRVHTD
Download sequence
Identical sequences A0A1S3GP01
ENSDORP00000006975 XP_012889979.1.60039 ENSDORP00000006975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]