SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006986 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006986
Domain Number 1 Region: 39-250
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.24e-80
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000021
Further Details:      
 
Domain Number 2 Region: 539-756
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-57
Family Ankyrin repeat 0.0000249
Further Details:      
 
Domain Number 3 Region: 246-375
Classification Level Classification E-value
Superfamily E set domains 1.66e-43
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000125
Further Details:      
 
Domain Number 4 Region: 806-886
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000165
Family DEATH domain, DD 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006986   Gene: ENSDORG00000007447   Transcript: ENSDORT00000007448
Sequence length 965
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1635:7387:77308:1 gene:ENSDORG00000007447 transcript:ENSDORT00000007448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDNPYGGTGQIFHLNTLSHTMFNTELFPPEMPLSTDGPFLQILEQSKQRGFRFRYVCE
GPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGI
CTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTDACIRGYNPGLLVHPELAYLQAEG
GGDRQLTDGEKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVISDAIYDS
KAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSP
TDVHRFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKR
QKLMPNFSDSFGGGSAGAGGRGMFGTGGGGGSSGSPGPGYGFPHYGFPTYGGITFHPGST
KSSAGMNHGTINTEYKDRSEGDGKCEDRETAHVPGKESEIPEQDNEPGKSRSSNDGVTLA
DLVGTKEEDTGGFQDHLFLEKAMQLAKRHANALFNYAVTGDVKMLLAVQRHLTTVQDENG
DSVLHLAIIHLHVQLVRDLLAVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLR
AGADLSLLDRLGNSVLHLAAKEGHDQILNILLKHKKAAPLIDHPNGEGLNAIHIAVLSNS
LPCLLLLVAAGADVNAPEQKAGRTALHLAVEQDNISLAGCLLLEGDAHVDSTTFDGTTPL
HIAAGRRSTRLAALLQAXXADPLVENFEPLYDPDDSWEKAGEDEGVVPGTTPLDMAANWQ
VFEILNGKPYEPEVTADDLPPQGDMKQLAENAKLQLYKLLEIPDPDKNWATLAQKLGLGI
LNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALQQMGYTEAIEVIQAASSPVKPTSQAHM
LPPSPSSVRRHIDELQDDSICDSGVETSFYKLSFTESLTSGGGSLLTLNKIPHEYRQEGP
IEGKI
Download sequence
Identical sequences ENSDORP00000006986 ENSDORP00000006986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]