SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006990 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006990
Domain Number 1 Region: 38-109
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00000000000732
Family SCAN domain 0.00086
Further Details:      
 
Domain Number 2 Region: 539-563,600-627
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000352
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 3 Region: 1071-1094,1123-1150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000605
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 1459-1531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000827
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 5 Region: 934-966
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000188
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 1191-1212,1242-1269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000521
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 7 Region: 613-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000406
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 8 Region: 426-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000552
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 9 Region: 476-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000123
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006990
Domain Number - Region: 1296-1317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0486
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006990   Gene: ENSDORG00000007451   Transcript: ENSDORT00000007452
Sequence length 1533
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6482:16704:30662:-1 gene:ENSDORG00000007451 transcript:ENSDORT00000007452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPLNHSLTTYPEKYWAPNLYELDSDLANEPDAILGELSQRFRNLLYVDSVGPQRTLATL
RKLCLDWLPEHTKEIIRLLVLEQPEKLKPWVRARQPDSCEKLVALLENPRMYQREDDANS
NGDMRWNRGGTPXXXXXXXXXDRDWDRRGRSRDVEPRDRWAHSRSPRGXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXDAESYRSVMEASEDRKSQNPIQDNMENYRKLLSLVQL
AEDDRHSHMTQGHSSRAKRSAYPSTSRGLKTMPEAKKPSHRRGICEDESSHGVIMEKFIK
DAAHGSRSGRAREPNDRLQRFPRVPDDHWRDSSLNRREPLAPQRGFEGSAFRGGFRFNPN
LISRRRALERKRRYHFDTEGKSGAHEHKGSARKKPFECGSEMRRATGTSSLLSSSSESQP
SDLGATSYVCDECGRSFTVISEFVEHQIMHTRENLYEYGESFVQSSTPNEGPSQSHQSGG
KRFECRECGEVFTKSAALAEHRRIHAREYLAECKDQESEEQALPSPTFSELQKMYGKDKF
YECRVCKETFLHSSALIEHQKVHEVGSCGGDEASERDHEPGRGAAFMPGAALREFQKMYG
KNKIYECKVCGDSFLHSSSLKEHLKIHARGNPFESKSPACEGAFTPSSSLKRRQKTYTKE
KFFDVKDGRDPFMQNADLSEQQKIHSRKNFFNGRGYEKSAVHSMPFTESQKSHTITRPPE
DEEEEKAFTISSNPDEAQTPPTKENAYEGKFYEKSNTHCLGSAEAQKSVSGFTKPAVPAM
PATHSSEVPNYMKACFGENSSAGKEYLASITRSLAIPRSLKRYYVNKEAGCDEKGESSTY
LSDLHNKRRKIPARESPYDGDSNDYRDATMPSTSYAEPQRSLAGDRAREFKQDGVFSVPT
TSVRSHQKARAKKKYIEPTVYHSLPFGELPIVRPREKLYECQECGESFYRSSDLIEHQKI
HDREKPSGSGHYEQSINHSMTTTSPQTSYTQEQYAEEQVHDKSNKSATNNSLLVQWAICT
QEKTPGEETHGEDTCDQGINSEESQGQETGEDTISQVSSSDEQKDEPEDTIYECQECGLG
FVYLTDLTSHQDVHSRKCLVDSREYALSDVHMHSLSEYQKECAGEQLFECPKCGESFIHS
SFLFEHQRVHEQDQLYSVKGCDDGFICLLPVKSRRSRAAERNPAVAGAAIRCLQCGQGFI
HSSALNEHLRHHRDEEFLEQTEAGEEIFIQTLALTEFQGSETEEKLFECTVCGECFFSQA
LGDHHTKVHKDEPYEYGASFTHASFLTEPLRRPGPFYECRDCGQAFMHDTILTKHTVFDP
EDEEDDEGGGGEAATAQEVEVNVLIPQEVLRIQGSNVEAAEPEVEAAEPEVEAAEPDVEA
AEPDGEAEGPDGEAAEADGEAEQPNGGAEYPIGDADEPDGVGIEDPEERVEEPEGDADEP
DAAGIEDPEEEGEEQERPYYNCQECTETFASSAAFREHLRAHASLVLPSNAPGEGAGPSA
AQWVDHQYFRCDVCGQLFNDRLSLARHQNTHTG
Download sequence
Identical sequences ENSDORP00000006990 ENSDORP00000006990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]