SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007061 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007061
Domain Number 1 Region: 130-223
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-23
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 18-78
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000135
Family Ankyrin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 235-277
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000034
Family SOCS box-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007061   Gene: ENSDORG00000007528   Transcript: ENSDORT00000007528
Sequence length 278
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6316:4852:26030:-1 gene:ENSDORG00000007528 transcript:ENSDORT00000007528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRAADGYFLGDVGFWVERTPVHEAAQRGESLQLQQLIENGACVNQVTVDSITPLHAAS
LQGQARCVQLLLAAGAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAK
FHEDALYHAAKVKNVDLIEMLIEFGSNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPL
TLSQLCRVTLRKATGVRGLEKIAKLNIPPRLIDYLSYN
Download sequence
Identical sequences ENSDORP00000007061 ENSDORP00000007061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]