SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007073 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007073
Domain Number 1 Region: 114-162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 2 Region: 150-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000426
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 457-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000157
Family Classic zinc finger, C2H2 0.047
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007073
Domain Number - Region: 94-121
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0239
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007073   Gene: ENSDORG00000007539   Transcript: ENSDORT00000007540
Sequence length 514
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_197:19200:156595:-1 gene:ENSDORG00000007539 transcript:ENSDORT00000007540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNELSPEREHSNMAIDLTSSTPNGQHASPSHMTSTNSVKLEMQSDEECDRKPLSREDEIR
GHDEGSSLEEPLIESSEVADNRKVQELQGEGGIRLPNGKLKCDVCGMVCIGPNVLMVHKR
SHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCSYACRRRDALTGHLRTHSV
GKPHKCNYCGRSYKQRSSLEEHKERCHNYLQNVSMEAAGQVMSHHVPPMEDCKEQEPIMD
NNISLVPFERPAVIEKLAGNMGKRKSSTPQKFVGEKLMRFSYPDIHFDMNLTYEKEAELM
QSHMMDQAINNAITYLGTEALHPLMQHPPSTIAEVAPVISSAYSQVYHPNRIERPISRET
SDSHENNMDGPISLIRPKSRPPEREASPSNSCLDSTDSESSHDDHQSYQGNPALNPKRKQ
SPAYMKEDVKALDAAKAPKGSLKDIYKVFNGEGEQIRAFKCEHCRVLFLDHVMYTIHMGC
HGYRDPLECNICGYRSQDRYEFSSHIVRGEHTFH
Download sequence
Identical sequences ENSDORP00000007073 ENSDORP00000007073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]