SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007119 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007119
Domain Number 1 Region: 72-235
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.06e-41
Family Ankyrin repeat 0.00024
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007119
Domain Number - Region: 347-414
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000327
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007119   Gene: ENSDORG00000007590   Transcript: ENSDORT00000007590
Sequence length 469
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4138:20548:57405:-1 gene:ENSDORG00000007590 transcript:ENSDORT00000007590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSELRGPSMAGGRESSDSEDDGWDIGSLDRSSQXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXINVDSSFQYGWTPLMYAASVANVELVRFLLDRGANASFSKDKVTILITAC
SASGSEEQILKCVELLLSRNADPNVACRRRMTPIMYASRYGHTQVVVLLVAHGAEVNAQD
ENGYTALTWAARQGHKNVILKLLELGANKMLQTKDGRTPSEIAKRNKHLEIFSFLSLTLN
PLEGKLQQLTKEETLCKLLAADSDKEKDHIFXXXXXXXXXXXXXXXXXXXXXXXXXXERD
ITLRHLLSMKKDEFTKNGITSKDQQKILAALKLEVEINFGELCEEAGDEFLNFLLKLNKQ
CGHLITAVQNIITELPVNSQKIVLEWASPRNFTSVCEELVTNVENLSEEVCKLKDLIQKL
QNERENDPTHIPLMEEVSTWKSRVLKWTAITVCGFGLFLFICKLTFQRK
Download sequence
Identical sequences ENSDORP00000007119 ENSDORP00000007119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]