SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007172 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007172
Domain Number 1 Region: 1511-1758
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.33e-48
Family WD40-repeat 0.0000814
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007172
Domain Number - Region: 17-51
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000437
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Domain Number - Region: 1802-1829
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0069
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007172   Gene: ENSDORG00000007649   Transcript: ENSDORT00000007651
Sequence length 1872
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6715:80612:116175:-1 gene:ENSDORG00000007649 transcript:ENSDORT00000007651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVGRIECPSSPSFPRDSSHECRVCGVTEVGLSAYAKHISGQLHKDNVDAQEREDDGKGE
EEEEEYFDKELVQLIKQRKEQNRQDESKSSQEINSDDRQPQWRREDRIPYQDRESYSQSA
RHHRGPPQRDWKWEKDGFNNTRKNSFSHPLRNAAGPRGSSGWHKGIARGSSGWFHNHSNS
GGGWHPNSGVVDWNYNATGRNSSWHSEGTGGFPSWHMNNNNGNWKSNVRSTNSWNYNGPA
DKFQQGRGRNTNYQMEDKTAPWNKKLSKASKYNAERYKWQWQEKDKASTFRGPSEGFASS
AFPSEGLLEFNFEPSESQTPKPTDPATSKMNGKNGNTAREKFRRWTPYPSQRNLDLLSGL
KEITSNKSEKIDKPLFNFSLITAGAQEPQAEEANNSPMLKTQKEIHSGFLNCKDVSEGTP
SCEERCPRTEPPEPPRSSEKRAPPKAPLLPLPAPKAAPQKRDPKNPPKPPEAHSRFPEEH
SNPLNKPAVEDDPGSSHVSKLRSPGPRGLKGNKTTSGTPKEPEENLNDTLEKVQERPPCP
KTLPSSSKRSRSHEKASRNVEGSEKGSLKMEFPVPAFEDESDGAASDMEKPEPKTRTAVG
STATETLSCSTHTADEKGDEESLETGRKPATSPCSATLLHKESDVHVAPTASPQAGLPLD
SKTAPEHAQGDDPAKSHALFETESFESTSLDPELQKNDTSQPSGPLLPELSKLGFPASLQ
RDLTRHISLKSKSGAHLPEPNLNSARRIRNISGHRKSETEKESGLKPTLRQILNASRRNV
NWEQVIQQVTKKKQELGKGLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGSSPEL
PSLERKNKRRKIKGKKERSQVDQLLSISLREEELSKSLQCMDNNLLQARAALQTAYVEVQ
RLLMLKQQITMEMSALRTHRIQILQGLQETYEPSEQSDQVPCSLPREARSRSQTTADTTL
LPNPFFPLFLEAAPSHVSPSSTRASLQLATSPAFQAQGNIPAPDSSVQIKQEPMSPEQEG
SVNSGSQGSDFSVSKELLHTQGEMSDSGPVHPGLPAGHCVSELTESGHEPNQDLNLSVEQ
GSSRSRANSPSSQSPDLPNLHKGELSAKGHSGSEAWSSSFLRSSLTSETPVQKEAHSAAE
QPEQQAESSLPSAETRANKKKKKLRKKKTLRAAHIPENSDTEQDVFMAKPVRKVKAGKFA
KGGKVTTSTWEDSRPRPEQESVRDEQESDSSLEVLEVPNPQLEVVAIESSESGEEKPDSP
SKKDTWNLAQQNPLGASRSGCDEVSSTSEIGTPYKDGAPVXXXXXXXXXXXXXXXXXXXX
ISSEPGEDDEPTEGSFEGHQAAVNAIQIFGNLLYTCSADTTVRVYSLVSRKCTGVFEGHT
SKVNCLLVTQTSGKNAALYTGSSDHTIRCYNAKTRECMEHLQLEDRVLCLHSRWRVLYAG
LANGTVVTFNIKNNKRLEIFECHGPRAVSCLATAQEGARKLLVVGSYDCTISVRDARNGL
LLRTLEGHSKTILCMKVVNDLVFSGSSDQSVHAHNIHTGELVRIYKGHNHAVTVVNILGK
VMVTACLDKFVRVYELQXXXXXXXXXXXXXXXXXXXXXXXXIYTGCYDGSIQAVRLNLMQ
NYRCWWHGCSLIFGVVDHLKQHLLTDHTNPNFQTLKCRWKNCDAFFTARKGSKQDAAGHI
ERHADDDSRIDS
Download sequence
Identical sequences ENSDORP00000007172 ENSDORP00000007172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]