SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007253 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007253
Domain Number 1 Region: 510-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.45e-18
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 2 Region: 352-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000571
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 3 Region: 409-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000889
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 4 Region: 563-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000122
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 5 Region: 315-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000471
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 165-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000065
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Domain Number 7 Region: 238-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000379
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007253   Gene: ENSDORG00000007739   Transcript: ENSDORT00000007739
Sequence length 626
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3253:18341:122823:-1 gene:ENSDORG00000007739 transcript:ENSDORT00000007739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMVTGSFSPKSFQVWDRMKFYLPYRERKGEKFGPFAGEKRMPEDLDENMDYRLMWEVRG
RKGEVLYILDATNPRHSNWLRFVHEAPSQEQKNLAAIQXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHWGCEEEHACSQCKLSFPSEEIL
AEHVQTLHQRATEEKEVKCKNCGKKFPVKQALQRHVLHCASSSPRNLSRSFQCSVGNSFS
SALNFEQHQKTCQGSARFVCKADSCGKRLKSKDALKRHQENVHAXXXXXXXXXXXXXXXX
XXXXXXXXXXXIHEIFDCQECMKKFISANQLKRHMITHSEKRPYNCEICHKSFKRLDQVG
AHKVIHSEDKPYKCKLCGKGFAHRNVYKNHKKTHSEERPFQCEECKALFRTPFSLQRHLL
IHNSERTFKCHHCEATFKRKDTLNVHVQVVHERHKKYRCELCNKAFVTPSVLRSHKKXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXERPYQCPYCEKGFSKNDGLKMHIRTHTREKP
YKCSDCSKAFSQKRGLDEHKRTHTGEKPFQCDVCDLAFSLKKMLIRHKMTHNPNRPLAEC
QFCHKKFTRNDYLKVHMDNIHSIADS
Download sequence
Identical sequences ENSDORP00000007253 ENSDORP00000007253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]