SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007268 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007268
Domain Number 1 Region: 166-196
Classification Level Classification E-value
Superfamily WW domain 0.000000000344
Family WW domain 0.0012
Further Details:      
 
Domain Number 2 Region: 125-157
Classification Level Classification E-value
Superfamily WW domain 0.00000000163
Family WW domain 0.00026
Further Details:      
 
Domain Number 3 Region: 9-50
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000223
Family HkH motif-containing C2H2 finger 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007268   Gene: ENSDORG00000007755   Transcript: ENSDORT00000007754
Sequence length 374
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2245:45764:64730:1 gene:ENSDORG00000007755 transcript:ENSDORT00000007754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYWKSQPKKFCDYCKCWIADNRPSIEFHERGKNHKENVAKRISEIKQKSLDKAKEEEK
ASKEFAAMEAAALKAYQEDLKRLGLESEIPEPSKSPIASTTPPTSSSNQQKEKKKKKKKD
PPKGRWVEGITSEGYHYYYDLITGASQWEKPEGFQGNLKKATEKSIWVEGLSEDGYTYYY
NVETGESKWEKPDDFIPHAGDVPSKSTVDEKSVGSLEESKSSVSRSDSTGEQEAEGEIPT
EREKLKITFKXXXXXXXXXXXXXXXXXXXXXXXXXNSSPKRENSKPFKKTNPYGEWQEIK
QEVSHEDVDLELPSAENEYVSTSEADVVEPKVVFKEKTVTSLGFAADGVAPVFKKRKLEN
GKARNLRQRGGDDQ
Download sequence
Identical sequences ENSDORP00000007268 ENSDORP00000007268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]