SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007405 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007405
Domain Number 1 Region: 323-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000106
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 2 Region: 447-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000015
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 487-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000151
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 372-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000018
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 5 Region: 280-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000554
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007405
Domain Number - Region: 534-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0108
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007405   Gene: ENSDORG00000007895   Transcript: ENSDORT00000007897
Sequence length 598
Comment pep:novel scaffold:dipOrd1:scaffold_11697:9222:11440:1 gene:ENSDORG00000007895 transcript:ENSDORT00000007897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIPRLLLARRTAQGGGGGGGGGGGPAGGGGGVHRGPDSPACQAPARRLLLLRGAQDGAP
GPRSDEEGLAGPRSPSPXXXXXXXXXXGGGGDDLFLLLLDPVGGDVESAGAEQAGGPVRR
EEAEAGLGPERGESGAQPASRPALVPRRLAAVPVPGLSPTPGPAAAFAGTITIHNQDLLL
RFENGVLTLTTPPLPAWEPGVAPFPQPQPGGPAAPPPAGFPQAAAAQLGDCPELPPDLLL
AEPAEPAPAPAPEEEAEGPAAAAQSPRGPLVPGHSGVVLYLCPEAQCGQTFAKKHQLKVH
LLTHSSSQGQRPFKCPLGGCGWTFTTSYKLKRHLQSHDKLRPFGCPAEGCGKSFTTVYNL
KAHMKGHEQENSFKCEVCEESFPTQAKLSTHQRSHFEPERPYQCAFSGCKKTFITVSALF
SHNRAHFREQELFACSFPGCSKQYDKACRLKIHLRSHTGERPFLCDFDGCGWNFTSMSKL
LRHKRKHEDDRRFTCPVEGCGKSFTRAEHLKGHSITHLGTKPFVCPVEGCCARFSARSSL
YIHSKKHLQDVDTWSRCPVSTCNKLFKHSMKTHMAKHTGDLLAQLEASLPPSSELTSQ
Download sequence
Identical sequences ENSDORP00000007405 ENSDORP00000007405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]