SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007449 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007449
Domain Number 1 Region: 100-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000564
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 1-48
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000163
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 41-91
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000129
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007449   Gene: ENSDORG00000007945   Transcript: ENSDORT00000007942
Sequence length 256
Comment pep:novel scaffold:dipOrd1:scaffold_51428:3:770:-1 gene:ENSDORG00000007945 transcript:ENSDORT00000007942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKLGYRRHLA
MHAASSGDLSCKVCLQTFESTQSLLEHLKAHSRRVAGGAKEKKHPCDHCDRRFYTRKDVR
RHLVVHTGRKDFLCQYCAQRFGRKDHLTRHVKKSHSQELLKIKTEPVDMLGLLSCSSTVS
VKEELSPVLCMASRDMMGAKAFPGMLPMGMYGAHIPAMPSTGMPHSLVHNTLPMGMSYPL
ESSPISSPAQLPPKYQ
Download sequence
Identical sequences ENSDORP00000007449 ENSDORP00000007449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]