SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007453 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007453
Domain Number 1 Region: 210-341
Classification Level Classification E-value
Superfamily Cap-Gly domain 3.14e-39
Family Cap-Gly domain 0.0000115
Further Details:      
 
Domain Number 2 Region: 354-467
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.96e-37
Family Cap-Gly domain 0.00000658
Further Details:      
 
Domain Number 3 Region: 45-180
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.93e-18
Family Ankyrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007453   Gene: ENSDORG00000007944   Transcript: ENSDORT00000007946
Sequence length 473
Comment pep:novel scaffold:dipOrd1:scaffold_32149:1428:11616:1 gene:ENSDORG00000007944 transcript:ENSDORT00000007946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTFFDPNDPACQEILFDPQTTIPELFAIVRQWVPQVQHKIDVIGNEILRRGCHVNDRDGL
TDMTLLHYACKAGAHGVGDPAAAVRLSQQLLALGADVTLRSRWTNMNALHYAAYFDVPDL
VRVLLKGARPRVVNSTCSDFNHGSALHIAASNLCLGAAKCLLEHGANPALRNRKGQVPAE
VVPDPMDMSLDKAEAALVAKELRTLLEEAVPLSCALPKVTLPNYDNVPGNLMLSALGLRL
GDRVLLDGQKTGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGVRYFICPPKQGLFAS
VSKISKAVDAPPSSVTSTPRTPRMDFSRVTGKGRREHKGKKKSPSSPSLGSLQQRDGAKA
EVGDQVLVAGQKQGTVRFYGKTDFAPGYWYGIELDQPTGKHDGSVFGVRYFTCPPRHGVF
APASRIQRIGGSTDPPGDSTGAKKVHQVTMTQPKRTFTTVRTPKDIASENSIS
Download sequence
Identical sequences ENSDORP00000007453 ENSDORP00000007453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]