SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007506 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007506
Domain Number 1 Region: 627-747
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-24
Family Ankyrin repeat 0.0000101
Further Details:      
 
Domain Number 2 Region: 571-599,757-814
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-18
Family SH3-domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007506   Gene: ENSDORG00000008001   Transcript: ENSDORT00000008001
Sequence length 825
Comment pep:novel scaffold:dipOrd1:scaffold_7554:20206:30373:1 gene:ENSDORG00000008001 transcript:ENSDORT00000008001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSEAFQSARDLLDLNFQSLAMKHMDLKQMELDTAAAKVDELTKQLESLWSDSPAPPGPQ
AGVSPRMPRYSSSPVSEPFGSRGSPRKTATDNADAPFGRSESAPSLHPYSPLSPKTRPSS
PRTPLYLQPDAYGSLDRAPSPRSRAFEGAGSPLGRAPSPRPGSGPLRQQGPPTPFDFLGR
AGSPRGSPLAEGPQAFFPERGPSPRPPASAYDVPAFGSLLGAGGSFAPPLRAQDDLTLRR
RTPKAWNESDLDVAYEKKSSQTASYERLDVFSRPSSPGLQLLPWRESSLDGLGAAGKDNL
TSATLPRNYKVSPLASDRRSDVGSYRRSLGSAGPSGTLPRSWQPVSRIPMPPAAPQPRNA
PRQRPIPLSMIFKLQNAFWEHGASRNVFPGSPVFPRAPPPKLPTQPQPPPQPQVHPQPQP
QVPPQPQPPAQPPTTTPQLPQQTWTPGNEGLLKPPTELEPEPELEGLLPPVLEAGDGEEC
TVTRSLSPTRLQLALPLEAQSVPELEEVARVLXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXPELTPITEGSEGRAGPAPASPAPIPPPAPPQSSPPEQPP
SMEMRSVLRKVGSPRKARRARLNPLVLLLDAALTGELDVVQQAVKEMNDPSQPNEEGITA
LHNAICGANYPIVDFLIAAGANVNSPDSHGWTPLHCAASCNDTAICTALVQHGAAIFATT
LSDGATAIEKCDPYREGYADCATYLADVEQNMGLMHNGAVYALWDYSAEFGDELSFREGE
SVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRNKV
Download sequence
Identical sequences ENSDORP00000007506 ENSDORP00000007506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]