SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007538 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007538
Domain Number 1 Region: 64-89,123-277
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.09e-37
Family Ankyrin repeat 0.00058
Further Details:      
 
Domain Number 2 Region: 280-322
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000183
Family SOCS box-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007538   Gene: ENSDORG00000008035   Transcript: ENSDORT00000008034
Sequence length 323
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1237:52510:80794:-1 gene:ENSDORG00000008035 transcript:ENSDORT00000008034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGPVFYGFRNIFITMFATFFFFKLLIKVFLALLTHFYIVKGNRKEAARIAEEIYGGIS
DCWADRSPLHEAAAQGRLLALKTLISQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXVNGVTIHGATPLFNACCSGSAACVSMLLEHGARAQLDMHLCSPIHEAVKRGHTECME
ILLANNVNIDQELPHIGTPLYVACTYEKEDCLKKLLELGANPDQGQWLNTPLHAAAKQSN
LEIIYTLVDYGANLRLRNAQGKIPLDLAAPKSSVAQALILCEGPPTLSQLCRLRIRKCLG
RSYRQTINQLHLPEPLERFLLYQ
Download sequence
Identical sequences ENSDORP00000007538 ENSDORP00000007538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]