SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007550 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007550
Domain Number 1 Region: 304-509
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.09e-66
Family DNA polymerase beta-like 0.0000000149
Further Details:      
 
Domain Number 2 Region: 150-241
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 5.36e-28
Family DNA polymerase beta, N-terminal domain-like 0.00000714
Further Details:      
 
Domain Number 3 Region: 243-300
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 3.43e-18
Family DNA polymerase beta-like, second domain 0.0000483
Further Details:      
 
Domain Number 4 Region: 36-120
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000278
Family DNA topoisomerase II binding protein 1, TopBP1 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007550   Gene: ENSDORG00000008047   Transcript: ENSDORT00000008047
Sequence length 510
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_978:60174:75334:1 gene:ENSDORG00000008047 transcript:ENSDORT00000008047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLPTAHSGPRKKRPRQMGALMSSTPQDVKFRDLVLFILEKKMGTSRRAFLMELARSKG
FRVENELSDSVTHIVAENNSGSDVLEWLQVQNIKASSQLEFLDISWLVECMGAGKPVQTT
GKHQLVVRRDHPPSSNPGLQNTLPQTAQKISQYACERRTTLNNWNHVFTDALDILAENSE
FRENESCCLAFMRASSVLKSLPFTVSSMKDTEGIPCLGDKVKCIIEEIIEDGESSEVKAV
LNDERYQSFKLFTSVFGVGLKTSEKWFQMGFRTLSKVRSDKSLKFTRMQKAGFLYYEDLV
SSVTKAEAEAVSMLVKEAVRTFLPSALVTLTGGFRRGKKIGHDVDFLITSPEVTEEKEQQ
LLHQVTNLWEKKGLLLYCDHVESTFEKLKLPSRKVDALDHFQKCFLILKLDHQRVNSDQS
SQQEGKTWKAIRVDLVMCPYERRAFALLGWTGSRQFERDLRRYATHERKMMLDNHALYDK
AKRIFLKAESEEEIFAHLGLDYIEPWERNA
Download sequence
Identical sequences A0A1S3FAV4
ENSDORP00000007550 XP_012873149.1.60039 ENSDORP00000007550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]