SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007575 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007575
Domain Number 1 Region: 365-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000681
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 2 Region: 948-998
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000299
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 746-774
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000458
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007575
Domain Number - Region: 325-334
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0068
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007575   Gene: ENSDORG00000008073   Transcript: ENSDORT00000008073
Sequence length 1014
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5240:182465:284563:-1 gene:ENSDORG00000008073 transcript:ENSDORT00000008073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WSQTQSISLTSXXXXXXXXXXXXXXXEAWYGNSSETPSEYGEVQENYKLCLEDPIQEQST
SPDTSLGSATPRSHTLELVALDGEVLRDSLPCQDHLSPGVSSLCDDEPPGSNKPLSSNLR
RLLEAGSLKLDATVPANGRVESPVNAGSNLSFSSPSHHAQQLSVLARKLAEKQDQNDQYT
PSSRFLWNQGKWLSTSTTACGLSPDSAILKLKAAANAVLQDKSLSRTEDTVRFESFSSPF
SSQSASSTLAALSKKVSERSLTPGQEHPPPASSFLSLASMTSSAALLKEVAARAAGTLLA
EKSSLLPDDSLPPPPSEKKPEKVSPPPPPPPPPPATQSLELLLLPVPKGRVSKPSNSASE
EESGKPFQCPICGLVIKRKSYWKRHMVIHTGLKSHQCPLCPFRCARKDNLKSHMKDSSSG
RSGDGRGTEIMGNAAAPNSAERTPPGGAGPPPSLVKEEPKEENGLPASFPASADDRPASL
LKPTDPSEFAAGPAAALFSQDISVKMASDFLMKLSAANQKEPMNLNFKVKEEPKEEEPLN
TPLPRSSYVFSPESEVASPSISEDTLKTQEGKGSGLRRDVSIKAASELLMKLSAESYRDT
QTVTVKEEPMEVDLQDSQVSISPSRNVGYSSLIGREKTEPLQKMPEGRVAPEKSLFSQDI
SVKMASELLFQLSEKVSKEHNHTKENTIRTSTSPFFTEDTFRQSPFTSNPKDLLPSEPAL
HGRIPAPETEKIVLEAGNGLPSWKFNDQLFPCDVCGKVFGRQQTLSRHLSLHTXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTMEEADIKAHIGSKHTGEDRKTPSESNSPS
SSSLSALSDSANSKDDSDGSQKNKGGNNLLVISVVPGSPPPLHSEEKPEKGFECVFCNFV
CKTKNMFERHLQIHLITRMFECDVCHKFMKTPEQLLEHKKCHTVPTGGLKRGGW
Download sequence
Identical sequences ENSDORP00000007575 ENSDORP00000007575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]