SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007657 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007657
Domain Number 1 Region: 1104-1278
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-40
Family BCR-homology GTPase activation domain (BH-domain) 0.00062
Further Details:      
 
Domain Number 2 Region: 668-742
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.16e-24
Family Pyk2-associated protein beta ARF-GAP domain 0.0041
Further Details:      
 
Domain Number 3 Region: 899-1019
Classification Level Classification E-value
Superfamily PH domain-like 8.58e-22
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 1404-1544
Classification Level Classification E-value
Superfamily PH domain-like 1.61e-21
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 5 Region: 480-558
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000453
Family Pleckstrin-homology domain (PH domain) 0.0000357
Further Details:      
 
Domain Number 6 Region: 1-60
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000338
Family SAM (sterile alpha motif) domain 0.0000942
Further Details:      
 
Domain Number 7 Region: 567-667
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000242
Family Pleckstrin-homology domain (PH domain) 0.045
Further Details:      
 
Domain Number 8 Region: 999-1091
Classification Level Classification E-value
Superfamily PH domain-like 0.000000115
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007657   Gene: ENSDORG00000008160   Transcript: ENSDORT00000008162
Sequence length 1679
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_270:9999:157007:-1 gene:ENSDORG00000008160 transcript:ENSDORT00000008162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMSINLEQYLLHFHEFGFYTVKDCASIDDSVLHKIGISPTGHRRRILKQLQIILSKMQEI
PIYANVHKTKNVDNSKEHHPATSPDQNICIEPLDSGNSQPSDLTQLETGSKNPTQNDIRM
ENPQNPMSDDKLSLSQHDLPITGDEIHQNLSSHDTLSGSENNEIDSSVSKKSMDCTTEEQ
QAGKVDLVSENLSELPNPVPECLSSLDYSTSEANSENGTNSLLGSSPSAPFFEFQGEMVI
NDLYVPSSPILSPMRSRSKLVSRPSRSFLLRHRPVPEIPGSKGVSGSYFRERRNVTTSPG
KPVTLKXXXXXXXXXXXXXXXXXXXXXXXXXXKRSIRNEFWTKEEKEEAATSRNSFLIRS
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXK
RMFQKRWVKFDGLTISYFNNEREMYSKGITPISAVSAVRAQGDNKFEVVTTQRTFVFRAE
KEEERNDWISILLNALKSQSLTSQSQAVVAPEKCGYLELRGYKAKIFTALRGSNVWLCKN
EQDFKCGLGITVIPMNANVKQVDRTVKQTFEIITPYRSLSFTAESEKEKQEWIEAVQQSI
AETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDSKVR
SLKMDASIWSNELIELFIVIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXALCAAVVKPDVLETMALLFSGADVMCTTGDSVHSTLYLLAKTAG
QSLQMEFLYHNFSFPQHDVHPEGGLGLETTQPTFLCDFLYQAPAAASRVSSEKKMLEETN
KKWCVLEGGFLSYYENDKSTTPNGTININEVICLSIHKEDFYLNTGPVFIFEIYLPSERV
FLFGAETTQAQRKWTEAIAKHFVPFVAENLTEADYDLIGQLFYKDCHALDQWRKGWFAMD
KSSLRFCLPMQEAQEDIMHLRRLQELTISTVVQNGEKLDMLLLVEKGRTLYIHGHSKLDF
TVWRTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVTQYGLGCKYIYQKNGDPLHIS
ELLDSFKKDARSFKLRAGKHQLEDVTGVLKRFLCDIDDALLTKELYPYWISALDTQDDKE
RTKKYGAFIRTLPGVNRTTLAAIIEHLYRVQKCSEINHMNAHNLALVFSSCLFQTEGQTS
DEVNVIEDLINNYVEIFEXXXXXXXXXXXXXXXXXXXXXXXVSQAGDLLIEVYVERKGPD
CSTIIRISPVMEAEELTNDILAIKNIIPAKGEVWATFEVIENEELXXXXXXXENVLEQVL
QSSLAEPGSAYLVVKRFLTADTIKHCRDTSIKEGVLKIKEEPSKILSGNKFQDRYFVLRD
GHLFLYKDPKSSKPDKMFSLSSMKFYLGVKKKMKPPTWGLTAYSEKHHWHLCCDSSQTQM
EWMASIFLAQHENDICPPAGKERKRSITKNPKIGGLPLIPIQPVKNATQARRSIESARAE
LERLRLSAMHDRESMDPSLKDRASMVAQCLEHKDDKLRNRTRKHRSFNCLEDTEAELPHG
VQKSNRGMKTLRKTEDRNNKATLDPDHKLPSKVIEELSVVLQRSRTLPKELQGEQILQK
Download sequence
Identical sequences ENSDORP00000007657 ENSDORP00000007657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]