SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007659 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007659
Domain Number 1 Region: 809-859
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000512
Family Ankyrin repeat 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007659
Domain Number - Region: 340-397
Classification Level Classification E-value
Superfamily Tropomyosin 0.00144
Family Tropomyosin 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007659   Gene: ENSDORG00000008164   Transcript: ENSDORT00000008164
Sequence length 992
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4527:13531:42922:-1 gene:ENSDORG00000008164 transcript:ENSDORT00000008164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKTDAKDQTSQGVEEKDPPKSHPYSVETPYGFHLDLDFLKYVDDIEKGNTLKRIPIHRR
AKQAKFSTLPRNFSLLDSGARPHVLLPQQNWSPVVPSKVSLGTPEHSQALRLGDPLQGPA
SGNELSYHRKALLAEASRQLEAPGPEDADLAPGTSRPQLLRASSMPATLLQNRASEEASV
GPGLPVSPALPPLLGEDSVCHGAFGPAEGFAGFHSSSPQASAQLTVLVQKGTESAEGEVE
TPKHLCLPGPPSSFQKIVPDDGEGEYRSRTEVVFTPDSSTPSPPPLPSPIPENELPLEEI
ELSISEIPPPPPVEVDVRSIGVRVTEESLGLVGLDPSAISSLKQQISALEGELSGSTEEL
AQVRAALQQHKEEIKAREQRIQELESSLAQLEEKLSQENARAAQVQIDAMVNTDPILGLI
PWESCDKSIGVNLSIADSESWGPRAQDYGLLRGQNSPTAGGQSPEERVPPHLSLPKGPEK
GLASSFCSCLSTELRIEEDVSEPDRSLQGGTRAVDGSSWSSHREATPAAMQEASAELPGK
EHPERPASSPTDVTIGQYVKKIQELLQEQWNCLEHGYPELASAIKQPASKLSSIQSQLLS
SLNLLLSAYSAQEPAQKDPSAPSSSPIEISPSTSLKSIMKKKDYGFRAGGNGTKKNLQFV
GVNGGYETTSSEDTSGEDSSPEDLSESEVEKKCDGPEPRQGRDAHPSCEPGQAVSQGILS
TPQEDGPGEEVSHPKTERCKPSEEFLNACRTLSQHLPETGTTPNQLLRQSLNTMSQEWFR
VSSRKSSSPAVVAAYLLGIQPHSPHLLKLLVNLADRNGNTALHYSVSHSNFAIVKLLLDT
GVCNVDHQNKAGYTAVMITPLASAETDEDMAVVWKLLREGNVNIQATQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLTDKAGHTA
LSITMKSPTSSAHVEIAELLQAHSERGRSLGL
Download sequence
Identical sequences ENSDORP00000007659 ENSDORP00000007659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]