SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007698 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007698
Domain Number 1 Region: 527-637
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-20
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 2 Region: 168-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-16
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 
Domain Number 3 Region: 343-459
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-16
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 4 Region: 289-351
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000695
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 703-764
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000118
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 643-701
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 7 Region: 771-837
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000315
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 8 Region: 464-529
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000511
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007698   Gene: ENSDORG00000008203   Transcript: ENSDORT00000008203
Sequence length 910
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1327:18102:42957:-1 gene:ENSDORG00000008203 transcript:ENSDORT00000008203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPKTQHPPPSQLLFLILLSCPWIQGLPLKDEEALPEPGSETPTEASEALAELLHGALL
RKGPEMAYLPGSDPDPTLATPPAGQTLTAPSLPRATEPATGPLTTAVTPKGVRGAGPTAP
ELLTPPPGTTAPPLPGPASPVPPLAPEGGEEETTTTIITTTTVTTTVTSPVLCNNNISEG
EGYVESPDLGSTGSRTLGLLDCTYSIHVYPGYGIEIQVQTLNLSQEEELLVLAGGGSPGL
APRLLANSSMLGEGQVLRSPTNRLLLHFQSPRVPRGGGFKIHYQAYLLSCGFPPRPTHGD
VSVTDLHPGGTATFHCDSGYQLQGEETLICLNGTRPAWNSEPPSCVASCGGIIHNATLGR
IVSPEPGGAAGPNLTCRWVIEADEGRRLHLHFERVSLDEDNDRLMVRSGGSPLSPVIYDS
DMDDVPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPE
YRPGALATFSCLPGYALEPPGPPNAIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLS
PDWPQSYSPSQDCMWILHVQEERRILLQVEILNVREGDMLTLFDGDGLSARVLAQLRGPQ
PRRRLLSSGPDLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHG
DLIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQKIVTCADPGEITNGHRTTSD
AGFPVGSHVQYRCLPGYSLEGAAVLTCYSRDTGTPKWSDRVPKCALKYEPCLNPGVPENG
YQTLYKHHYQAGESLRFFCYEGFELIGEVTITCVPGHPSQWTSQPPLCKVTQTTDPSRQL
EGGNLALAILLPLSLVIILGSGVYVYYTKLQGKSLFGFSGSHSYSPITVESDFSNPLYEA
GDTREYEVSI
Download sequence
Identical sequences A0A1S3EQY5
ENSDORP00000007698 ENSDORP00000007698 XP_012866808.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]