SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007787 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007787
Domain Number 1 Region: 465-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000223
Family Classic zinc finger, C2H2 0.0011
Further Details:      
 
Domain Number 2 Region: 559-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000054
Family Classic zinc finger, C2H2 0.0012
Further Details:      
 
Domain Number 3 Region: 434-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000722
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007787   Gene: ENSDORG00000008299   Transcript: ENSDORT00000008297
Sequence length 1575
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_591:85176:175642:1 gene:ENSDORG00000008299 transcript:ENSDORT00000008297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METSSPATSLEKKEAKSGILEGSGFPDPGKKACPLAVAAAAAVAAQGVPQHLLPPFHAPL
PIEMRHQEGRYHYEPHSVHSVHGPPTLSGSPIISDISLIRLSPHPAGPGESPFSAPHPYV
NPHMEHYLRSMHSSPTLSMISAARGLSPADVAHEHLKERGLFGLPAPGTNPSDYYHQMTL
MGGHPAPYGDLLMQSGGATGAPHLHDYLNPVDVSRFSSPRVTPRLSRKRALSISPLSDAS
LDLQRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGALSPAFTFPHPINPVAYQQILHQ
QRSLRSAFGHTPPLIQPSPTFLAQQPMALTSINAAPTQLNSSSSNCLSDTSQNKQSSESA
VSSTVNPITIHKRSKVKTETEGLRPASPLGLTQGSLSGYSYRCGLLPQEQLADLKEDLDR
DDCKQEAEVVIYETNCHWADCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKP
FKAQYMLVVHMRRHTGEKPHKCTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDV
HLRAPLLKENGDEASAEPGGRGSEDNAEASSTSQAVEDCLHVKAIKTESSGLCQSSPGAQ
SSCSSEPSPLGSVPNNDSGVEMPGPGPGSLGDLTALDDTSPGGDPPALAAPSAGGLQLRK
HMTTMHRFEQLKREKLKSLKDSCSWAGPAPHTRNTKLPPLPASGSVLENFSGTVDGGPAG
LLPNPRLSQLSASEVTMLSQLQERRDSSTSTVSSAYTVSRRSSGISPYFSSRRSSEASPL
GASRPHNASSADSYDPISTDASRRSSEASQCSGGSSGMLNLTPAQQYSLRAKYAAATGGP
PPTPLPGLERMSLRTRLAMLDVPDRTLPGIYPHSLGPRRGSDGPAYGHGHIGAAPAFPHE
APGGGARRASDPVRRSEALTLPRVQRFHSAHNVNPGPLPPCNTERRGLRLQGHPSTNSSL
IHSSYSPRPPSISENVVMEAMAAGVDSTGPESGLGLAEDDLVLPDDVVQYIKAHTSSTVD
ESTRQVYPSQSFPENPKLPSPGLHGHRRLAAADSNMGPSVPSMEGCQLGYGASSSLNKNN
MPVQWNEVSSGTMDAMPNQVKPPPFPQGNLAVVQQKAAFGQYPSYSPQGLQLSPGSLDST
QPHLQLPSGASSAPRVNYMQQQLRQPATGGQGLSLSSAVSPQTNYSQAHPQLSPSGTLNQ
FPPSCNNMGAKPAHLGLPQQMEVASNPTMMGSHHQELGVPNSALAGVPPPHPAQSYPQQS
HHLAATPSQEGYRQGLLSSHQPGFMEPQQGMMGAAPSSFGLVQPRPPLEPSPAGRHRGVR
AGQQQMAYARASGHAMVTTSANQETAEAVPKGAVGTMGSLPPQDRGGAQDHNTLYYYGQI
HMYEQNGGLENHGGCPAPQPQPPQPQACPDNIQPQPLPSPGVNQVSSTVDSQLLEAPQID
FDAIMDDGDHSSLFSGALSPSLLHNLSQNSSRLTTPRNSLTLPSIPSGISNMAVGDMSSM
LSSLAEENKFLNMMT
Download sequence
Identical sequences ENSDORP00000007787 ENSDORP00000007787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]