SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007795 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007795
Domain Number 1 Region: 460-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.48e-20
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 2 Region: 294-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 405-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 238-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-17
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 5 Region: 502-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 335-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000694
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 7 Region: 3-40
Classification Level Classification E-value
Superfamily POZ domain 0.000000942
Family BTB/POZ domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007795   Gene: ENSDORG00000008306   Transcript: ENSDORT00000008305
Sequence length 731
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_435:33513:39834:-1 gene:ENSDORG00000008306 transcript:ENSDORT00000008305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGQVLEFMYTAKLSLSPENVDDVLAVASFLQMQDIITACHALKSLTEPASSPGENAESSA
MEGADKRAKEEKAAAAALSRLDQARSSVPTGLGREPKEERGGQAKSAASGAEQTEADAPR
GPRPVELKPGPTISMAAAEAAALSESSEQEMEVEPASKGEERAEEGPAPGVQLQGARPPL
ENGEGEGPEDTEGSAGTDSGQELGAEPRSLRSGTYGDRTESKAYGSVIHKCEDCGKEFTH
TGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLKPYGCEECGKSYRLISLL
NLHKKRHSGEARYRCGDCGKLFTTSGNLKRHQLVHSGEKPYQCDYCGRSFSDPTSKMRHL
ETHDTDKEHKCPHCDKKFNQWGTLKAHLIHIADGSLKCRECGKQFIXXXNLKRHLRIHSG
EKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVICGKAFTQASSLIAHVRQHTGEKPY
VCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHTGEKPYLCDK
CGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGGEVSVVTVDDMVTLATEALAATAVTQL
TGPATLPSVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANS
AQHVRIHTAQALVMFQTDADFYQQYGPGSTWPAGQVLQAGDLVFRPRDGAEGQPALAETP
PAVYECPPHAE
Download sequence
Identical sequences ENSDORP00000007795 ENSDORP00000007795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]