SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007829 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007829
Domain Number 1 Region: 1695-1733
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000414
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 2 Region: 1621-1667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000109
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 3 Region: 1546-1598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000716
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 1399-1449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000927
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007829
Domain Number - Region: 238-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000264
Family HkH motif-containing C2H2 finger 0.073
Further Details:      
 
Domain Number - Region: 1523-1555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000941
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number - Region: 1032-1062
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00256
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number - Region: 691-734
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00702
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number - Region: 1466-1496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0121
Family Classic zinc finger, C2H2 0.075
Further Details:      
 
Domain Number - Region: 584-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0158
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number - Region: 995-1039
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0368
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007829   Gene: ENSDORG00000008342   Transcript: ENSDORT00000008342
Sequence length 2207
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6768:7497:317072:1 gene:ENSDORG00000008342 transcript:ENSDORT00000008342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDSEVKPENDEDANRKKVAGELRSLLSCGGSCGPGAEVTTISSENITSKRGFPDSSDFG
GVVQEGRNEHASKRMRVEETQCLKSGRQDTDGLSTPVSSTTEADIPSDEMGKAPFLKDWP
EGGTALPPASISSPDLSTINAPSLKRDTERRPAQEVVSLDSQRESSFPPKDMSVSCTFRN
IDAVLKCSECGHLFPSCSDLEKHAECPKQQAKEHACCRCGHKAESSPACQAHEHACSPVF
SCDLCGFQCGEENLLNAHYLSKTHLRRQNLAARGGFVQILTKQPFPKRTCAVVTKNARAR
PRASKPEAKNVDSKGLQNSGSTFTDCGVNISQQGGGDSELLVEMEPSRNTSLEKAEVVEN
VLSLTIAQNPENESKQVGVTPEGPLGKSESTPNTLRAAHGISTTSRLRPERSVVMLGNGF
RRRSGTFALKGQAKKRFNLLGINKRGASETQRTYMKHFRTQIKTSDTEPGLKPAEMSTRV
RSLCVTSSAPLDTTQDEASSCPLGSVPLDSPTEKPASDHQKSCTCTICGQIAINMSDLES
HVNRCHAEEVKNYRQACDLSNTSRGDPEEHAHKTQHQQTASVLTCQCCSFLSSSKRNLKD
HMKEKHDMDFLCTACNLFLSEKDVEEHKAATKHVSLLVQAKTSPSLANDCALQTLPLRSL
ESENTKESPNESGRTAQEEPMKSRVSPGSELRHSSKPQFQCKKCFYKTRSSTVLTRHIKL
RHGQDYHFLCKACNLYSLSKEMEKHIKRSKHLENAKNNIGLCFEECIERVCIGNEKDDFN
ISGNGKTDHVVQLQEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXCKCKYTVTKGDMRHCATKKHKGRVEIEANGKQ
SSDIIVVPEGGHIEACVKNTHSAVTMSDEPSNKSPESDTFVLEKPVVGHGNPTEVEVENV
LQALDGEVQSAVTGKKEQVSLQPEIVLQQGDICAQRDATGTSDNKCLHCEFSAHSPASLE
LHVKRKHTKEFEFYCMACDYYAVTRREMTRHAATEKHKMKRQSYLNSSNGEEAGSAEMSK
NTIIPGEEHPQNPKDFEIIPDQPPDTLKPRNASDCSILDENTNLDISKVLCAPDAVEIEE
ESNFSEAHSFSETFQQPPAKDQVMKPEEMVSVNISSSYGSSNRLQNENPGSCALNCETAK
LNRGILESIDKPHTYCENSGGNVGDGGAKCDRNACPGALCGKHPSESTSPLVVGINREKP
DLNSGGQNKVGCAQNSEALKDLQENPILPNKEILMNSQQETEIILEEDGPASESTVVSSD
VYETIISIDDKGQAMYSFGRFDSSIIRIKNPEDAELIDQSEECLVGTGVRVTELSLKDCA
PGLKKKKVEGSSYGESPRIRCDDCGFLADGLSGLNVHIAMKHPTKEKHFHCLLCGKSFYT
ESNLHQHLASAGHMRNEQASVEELPEGGATFKCVKCTEPFDSEQNLFLHIKGQHEELLRE
VNKYIVEDTEQINREREENQGSVCKYCGKMCRSSNSMAFLAHIRTHTGSKPFKCKICHFA
TAQLGDARNHVKRHLGMREYKCHVCGVAFVMKKHLNTHLLGKHGVGTPKERKFTCHLCDR
SFTEKWALNNHMKLHTGEKPFKCTWPTCHYSFLTASAMKDHYRTHTXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXEKPFKCDECNFASTTQSHLTRHKRVHTGEKPYRCPWCDYRSYCTE
NIHKHILDSGEHDCVMMYLPQCDYRTNVPVEFRNHLKEQHPDIENPDLAYLHAGIVSKSY
ECRLKGQGATFVETDSPFTAAALAEESPAREKARGGRRPAPAAEPLQQLIIIQGYDGELA
LDASVEETAAATLQTLALAGQVARVVHITEDGQVVATSPSGTPGGGAAPAPLLPEQLDGA
TQVVVVGGSVEGHGVDEALGPGEAAAKQEILSLSEAAGSPPEAASALDALLCAVSELGEV
QGRDKGRPGPKQVLVQLPHPEDARPSPETPQTQPFPDPQEGLAQAARPTAITASQERAQV
AFKRMVQGVLQLAVCDPAAAGQLLKDGVTQVLVNEEGAVHMVTGEGTQLIMQEAPAERVD
LVESEGEISQIIVTEELVQAMVGEAGSGFPEGTTHYIVTELPSAGPEPEAVYSHALMEAG
AQEILQAEAVAPGGVGQLASMVIYTQDRTTAAAVVQGQRESGELRDA
Download sequence
Identical sequences ENSDORP00000007829 ENSDORP00000007829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]