SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007921 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007921
Domain Number 1 Region: 162-291,343-654
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3e-67
Family RNA helicase 0.066
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007921
Domain Number - Region: 1068-1078,1110-1142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0358
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007921   Gene: ENSDORG00000008437   Transcript: ENSDORT00000008439
Sequence length 1143
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2923:2755:15188:1 gene:ENSDORG00000008437 transcript:ENSDORT00000008439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSPGTREGRDRRDHHRAPSAKEAPEKWDWNCPETRGLLEDTFFGDGGCIRRGSEDCQKF
WTFFERLQRYQSLRPSRKEETEPGSPPHGLPALADLPRTYDPRYRINLSILGPDPRGSRG
LATRLPPERVSEFRRALLHYLDFGQKQAFARLAKLQRERAALPIAQYGRRLLQTLAEHQV
VVVAGDTGCGKSTQVPQYLLAAGFSHVACTQPRRIACISLAKRVAFESLSQYGSQVGYQI
RFESTRSSATKIVFLTVGLLLRQIQREPSLPQYQVLIVDEVHERHLHXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVYQPQEAEPATSKSEKLDPR
PFLRVLETIDNKYPPEERGDLLVFLSGMAEISSVLEAAQTYASHTQRWIVLPLHSALSVA
DQDKVFDVAPPGVRKCILSTNIAETSVTIDGIRFVVDSGKVKEMSYDPQAKLQRLQEFWI
SQASAEQRKGRAGRTGPGVCYRLYAESDYDAFTPYPVPEIRRVALDTLVLQMKSMSVGDP
RTFPFIEPPPPASLETAILYLRDQGALDSSEALTPIGCLLAQLPVDVVIGKMLILGAMFS
LAEPVLTVAAALSVQSPFTRSAQGSLECAAARRPLESDQGDPFTLFNVFNAWVQXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXVRDKMSRSHQLLTFVSLLETNKPYLVNCVRVPA
LQSLLLLSRSLDTSGDCSRLVADGWLELRLADSESAVRLLATSLKLRARWESALDQQLAR
QALRRREEEEEERLPIHSKEVAALGRELLQFMASKVPYSLRRLTGLETQNLYVGPQTVTT
APSLPGXXXXXXXXXXXXXXGYVVTDFLTYNCLVSDTDLYSDCLRTFWTCPHCGLHLPLT
PLERMAHENTCAQAPQEDGAEAEEAPAPIQKASALQRPYHCDTCGQDFLFSPTEALRHRR
QHL
Download sequence
Identical sequences ENSDORP00000007921 ENSDORP00000007921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]