SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007944 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007944
Domain Number 1 Region: 469-793
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.83e-51
Family Diacylglycerol kinase-like 0.01
Further Details:      
 
Domain Number 2 Region: 281-354
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000168
Family Ras-binding domain, RBD 0.011
Further Details:      
 
Domain Number 3 Region: 60-122
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.003
Further Details:      
 
Domain Number 4 Region: 3-52
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000192
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.017
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007944
Domain Number - Region: 183-235
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000266
Family Ras-binding domain, RBD 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007944   Gene: ENSDORG00000008460   Transcript: ENSDORT00000008462
Sequence length 823
Comment pep:novel scaffold:dipOrd1:scaffold_21273:638:8056:1 gene:ENSDORG00000008460 transcript:ENSDORT00000008462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPVAHCFGSRGLYKRKFCGVCRKGLEVPALRCEVCELHVHPDCVPFACSDCRQCHQDGHQ
DHDMYLHHWREGNLPSGARCEVCKKSCSSSDVLAGVRCEWCGAQAHSVCCAVLGPECSFG
RLRSMVLPPACVRLLSRNFSKLHCFRIPETAALELGNGEDGVDGSVATGPSREALAALDS
SKQTLKIFDGNDAMRRNQFRLVTVPRLARSQEVLEVALRAYYVNEDPGDFELQALPLPSL
ASDTRKTGSGGTAEEEASGGPGTREPMPEAWVIRALPRAQEVLKIYPGWLKVGVAYVSIR
VTPQSTAQAVVLEVLPLFGRQTEDPENFQLIELMGSSQRTVLEGEELLLHRLLDIRQTSV
RQVSQTRFYVTENRAVAPHVSLLVSGLPLGLSPQEYSSLLHEAMATKAAVVSVSHVYSSQ
GAVVLDVTCFAEAERLYMLVRDTTLHGRPLTALVLPEVLHTKLPPDCSPVLVFVNPKSGG
LKGRDLLCSFRKLLNPHQVFELTNGGPLPGFHLFSQVPCFRVLVCGGDGTVGWVLTTLEE
TRHHLACPEPSVAILPLGTGNDLGRVLRWGAGYNGEDPFSVLVSVDEADSVLVDRWTILL
DAHEMGSAENKAADLEPPKIVQMSNYCGIGIDAELSLDFHQAREEEPGKFTSRFHNKGVY
VRVGLQKISRSRGLHKEVRLQVEQQEVELPSIEGLIFINIPSWGSGADLWGSDSDSRFEK
PRMDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLFKATPVQVDGEPWIQAPG
HMIISAAGPKVHMLRKAKQKPRKAGTVREAHVDALPAPEGDPK
Download sequence
Identical sequences ENSDORP00000007944 ENSDORP00000007944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]