SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007962 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007962
Domain Number 1 Region: 8-122
Classification Level Classification E-value
Superfamily POZ domain 8.11e-31
Family BTB/POZ domain 0.00094
Further Details:      
 
Domain Number 2 Region: 395-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000208
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 374-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000018
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007962   Gene: ENSDORG00000008483   Transcript: ENSDORT00000008482
Sequence length 503
Comment pep:novel scaffold:dipOrd1:scaffold_9003:34416:42352:-1 gene:ENSDORG00000008483 transcript:ENSDORT00000008482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKSGNIQLEIPDFSNSVLSHLNQLRMQGRLCDIVVNVQGQAFRAHKVVLAASSPYFRDH
MSLNEMSTVSISVIKNPTVFEQLLSFCYTGRICLQLADIISYLTAASFLQMQHIIDKCTQ
ILEGIHFKINVAEVEAELSQTRTKHQERPPESHRVTPNLNRSLSPRHNTQKGNRRGQVSA
VLDIRELSPPEESTSPQIIEQSSDVESREPIFCINRAGQWYVETGVADRGAPSDDEVRVL
GAVHIKSENLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGHGSVGQDSYTLGSSGAKVAR
PTSSEVDRFSPSGSVVPMTERHRARSESPGRMDEPKQPSSQVEESAMMGVSGYVEYLREQ
EVSERWFRYNPRLTCIYCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQLEYHI
RKHTGNKPFHCHVCGKSFPFQAILNQHFRKNHPGCIPLEGPHSISPETTVTSRGQGEEES
PSQEETVAPGETAQGSVSTTGPD
Download sequence
Identical sequences ENSDORP00000007962 ENSDORP00000007962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]