SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008014 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008014
Domain Number 1 Region: 80-195
Classification Level Classification E-value
Superfamily POZ domain 1.41e-26
Family BTB/POZ domain 0.0021
Further Details:      
 
Domain Number 2 Region: 614-671
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-19
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 3 Region: 576-628
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-16
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000008014
Domain Number - Region: 713-739
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000829
Family Classic zinc finger, C2H2 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008014   Gene: ENSDORG00000008535   Transcript: ENSDORT00000008535
Sequence length 741
Comment pep:novel scaffold:dipOrd1:scaffold_128:15123:61013:-1 gene:ENSDORG00000008535 transcript:ENSDORT00000008535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLERKKPKTAENQKASEENEITQPGGSSAKPGLPCLNFEAVLSPDPALIHSTHSLTNSHA
HTGSSDCDISCKGMTERIHSINLHNFSNSVLETLNEQRNRGHFCDVTVRIHGSMLRAHRC
VLAAGSPFFQDKLLLGYSDIEIPSVVSVQSVQKLIDFMYSGVLRVSQSEALQILTAASIL
QIKTVIDECTRIVSQNVGDVFPGIQDSGQDTPRGTPESGTSGQSSDTESGYLQSHPQHSV
DRIYSALYACSMQNGSGERSFYSGAVVSHHETALGLPRDHHMEDPSWITRIHERSQQMER
YLSTTPETTHCRKQPRPVRIQTLVGNIHIKQEMEDDYDYYGQQRVQILERNESEECTEDT
DQAEGTESEPKGESFDSGVSSSIGTEPDSVEQQFGAGASRDGQTEPAQPEQATEAPAEGG
AQPNQLETGASSPERSNEVEMDNTVITVSNSSDKGVLQQPSINTSIGQPLPSTQLYLRQT
ETLTSNLRMPLTLTSNTQVIGTAGNTYLPALFTTQPAGSGPKPFLFSLPQPLAGQQTQFV
TVSQPGLSTFTAQLPAPQPLASSAGHSTASGQGEKKPYECTLCNKTFTAKQNYVKHMFVH
TGEKPHQCSICWRSFSLKDYLIKHMVTHTGVRAYQCSICNKRFTQKSSLNVHMRLHRGEK
SYECYICKKKFSHKTLLERHVALHSASNGTPPAGTPPGARAGPPGVGACAEGTTYVCSVC
PAKFDQIEQFNDHMRMHVSDG
Download sequence
Identical sequences A0A1S3G7M6
ENSDORP00000008014 XP_012884042.1.60039 ENSDORP00000008014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]