SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008099 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008099
Domain Number 1 Region: 142-182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 24-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000445
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 564-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000575
Family TSP-1 type 1 repeat 0.00082
Further Details:      
 
Domain Number 4 Region: 699-756
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000256
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 5 Region: 644-700
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000256
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 6 Region: 80-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000102
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000008099
Domain Number - Region: 808-838
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00549
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number - Region: 516-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0246
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008099   Gene: ENSDORG00000008629   Transcript: ENSDORT00000008629
Sequence length 873
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_238:18576:81900:-1 gene:ENSDORG00000008629 transcript:ENSDORT00000008629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARYSVLYFILLSTLIDRDQACFCDHYPWTPWSSCSKTCNSGTQSRQRQIVMDSYYWDNS
CDQICTKQETRACNWQMCPINCLLGDYGPWSDCDPCVGKQFKIRSVLRPSQFGGQPCTEP
LSTFQPCIPSKLCRIEEADCKNKFRCDSGRCIPNRLECNGENDCGDNSDEKDCGRTKAVC
PRQYTPIPSAQLMGAGFHFLAGEPRGEVLDNSFTGGMCKTVKSSRASNPYRVPANLENVN
FEVKTEEDDLETDFYKDLINFGKNENQNKILSASQKGSSGVPFLFSKKKSKSINQNWAFK
QAIQASHKKDSSFIRVHKVIKVLNFTMQATNLQLSNVFLKALNQLPLEYNSAMYSRIFDD
FGTHYFTSGSLGGVYDLLYQFSSEELKNSGLTEEETQNCVRIETKKRSFFGKKKKVEHRC
TTNRLSEKHEGSILQAAEKAISLVQGGRSEYAAALAWEKGNSGPEEKVFSEWLESVKENP
AVVDFELAPIMDLVRNIPCAVTKRNNLRKAFQEYAAKFDPCQCAPCPNNGRPMLSGTECV
CVCQSGTYGENCEERSPDFKSSAVDGNWGCWSSWSACNAAYKRSRTRECNNPAPQQGGRR
CEGEERQEEHCTFSIMENIGQPCISDEEEMKEVDLPEIETDSGCPQPMLPENXXXXNEKK
LYSIGEEIEIACLTGFKAAGYQYFTCLPDRTWRRGDVECQRTECLKPIFQDVLTITPFQR
IYRLGESIELSCPKGFTVAGPSRYTCQGDSWTPPIPNSLTCEEXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXHYSEDLCVFDLGSNHYFTSHCTFLAKRCLNNEQLHFLHIGSCQDGP
QLEWGLERMKLAFNSTKKELCGFDTCYDWEKCS
Download sequence
Identical sequences ENSDORP00000008099 ENSDORP00000008099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]