SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008112 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008112
Domain Number 1 Region: 203-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000041
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008112   Gene: ENSDORG00000008644   Transcript: ENSDORT00000008644
Sequence length 260
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_151:5431:8217:-1 gene:ENSDORG00000008644 transcript:ENSDORT00000008644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVKKHFNSKKPNYSELDTHTVIISPYLYESYPMPVIPKPEILSSGAYSPITVWTT
TAPFHSPLAGFPSALGRMSPPPPSDTSSKDHSGSESPISXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSK
TFSRMSLLHKHEESGCCVAH
Download sequence
Identical sequences ENSDORP00000008112 ENSDORP00000008112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]