SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008133 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008133
Domain Number 1 Region: 8-60,104-164
Classification Level Classification E-value
Superfamily POZ domain 8.37e-22
Family BTB/POZ domain 0.0049
Further Details:      
 
Domain Number 2 Region: 317-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000132
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 220-242,290-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000682
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000008133
Domain Number - Region: 712-775
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00182
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008133   Gene: ENSDORG00000008665   Transcript: ENSDORT00000008665
Sequence length 997
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5496:96358:100245:-1 gene:ENSDORG00000008665 transcript:ENSDORT00000008665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPAEVTDPSHAPAVLRQLNEQRLRGLFCDVTLIAGDTKFPAHRSVLAASSPFFREALL
ASAPLALPPVTGGSAPNPTTTTAASSSSSYSSSSSSSSSPPPTSPSASSPPRVLELPGVP
AAAFSDVLNFIYSARLALPDGGGDGAAVAEIGALGRRLGISRLQGLGEGGDAWVPPTPAP
VATSQPEEDSFHPGPRPDGEWEDDKMETPDSQPPLSRRSLPCPRCGKTFIHPKRLQTHEA
QCRRGANSRVSTGLGAGGPGPGGPAGVDASALPSPVSFRGGPEHLVKVVGGHVLYVCAAC
ERSYVTLSSLKRHSNVHSWRRKYPCRYCEKVFALAEYRTKHEVWHTGERRYQCIFCWETF
VTYYNLKTHQRAFHGISPGLLASEKTPNGGYKPKLNTLKLYRLLPMRAAKRPYKTYSQGA
PEAPLSPRLHPPAPVAMPSSPPPKPPPAPEPGPPPSVITFAHPAPSVIVHGSGGSSSGGA
TGGGLASTGGAQAASVITYTAPPRPPKKREYPPPPPEPAATPTRPASTTVSPATAAGPGT
ATEETKSRNPRAGRTLTYTAKPVGGVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXSLSGEEVDESEEEEEEEEEEEEDNEEESKASGEDQLWRPYYSYKP
KRKAGATSGGSSGGNGIPRSRRPPRWRQKLDRRGWEESPALEVPTGRPRGERRHHCGDCA
QTFPNLRKLRKHQEAHSGGSHSSRTGRRPSTRFTCPHCAKVCKTAAALSRHGQRHAAERS
GGTPTPVIAYSKGSVGTRPGAVKEEAPQEMQVSSSSGEAGGGSAAAEEAPDTASLQDPVI
SGGEEPPVVVGGSHGYPPVQEFPLALIGSGREPGGGRGKAGGEGPVGASQGDQMEAAKVT
FYPEPYPLVYGPQLLAAYPYNFSNLAALPVALNMVLPDEKGGGALPFLPGVFSYTVNPQA
APPTPPTPPPPILPPSGPPKGEGERAGVDRTQKGDVG
Download sequence
Identical sequences ENSDORP00000008133 ENSDORP00000008133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]