SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008156 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008156
Domain Number 1 Region: 352-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.63e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 390-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000108
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008156   Gene: ENSDORG00000008688   Transcript: ENSDORT00000008688
Sequence length 449
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2512:11971:97506:-1 gene:ENSDORG00000008688 transcript:ENSDORT00000008688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EADHVETAILDEDEGLEIEEPSGLGLMVGGPDPDLLTCGQCQMNFPLGDILVFIEHKKKQ
CGGSLGVCYDKGLDKGSPPPSSRAELRKVSEPVEIGIQVTPDEDEHLLSPTKGICPKQEN
ITGPCRPAQLPAMAPIAASSSHPHTSVITSPLRALGALPPCFPLPCCSARPLSGDGTQGE
GQTEGPFGCQCQLSVGDGEENEHGGGGGGLGGLGPGADPFPGLFPRKPAPLPSPGLNSAA
KRIKVEKDLELPPAALIPSENVYSQWLVGYAASRHFMKDPFLGYTDARQSPFATSSEHSS
ENGSLRFSTPPGDLLDGGLSGRSGTASGGSTPHLGGPGPGRPSSKEGRRSDTCEYCGKVF
KNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHGQIGKEVYRCDICQMPFSV
YSTLEKHMKKWHGEHLLTNDVKIEQAERS
Download sequence
Identical sequences ENSDORP00000008156 ENSDORP00000008156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]