SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008159 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008159
Domain Number 1 Region: 3-137
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.34e-28
Family Ankyrin repeat 0.00083
Further Details:      
 
Domain Number 2 Region: 343-403
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000436
Family SAM (sterile alpha motif) domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008159   Gene: ENSDORG00000008693   Transcript: ENSDORT00000008691
Sequence length 417
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5552:883:8281:1 gene:ENSDORG00000008693 transcript:ENSDORT00000008691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTRYHQAASDGYLDLLKEATKRDLNLCDEDGMTPTLLAAYHGNLEALEVICSRGGDADR
CDIWGNTPLHYAASNGHAHCVSFLINFGANIFALDNDLQSPLDAAASREQNECVALLDKA
ATAQNIMNPKKVTRLKEQAQKNVQRQIKECARLQEKHQNKMTRTYSKEDSGMPSSKGTFS
RSTTSHASVPGTFGSLSKGIKDTFKLKFKKSKDTAEQVGKGERSGQRNVMEVFREEEEDS
VSGDFKEKLHFSMEEDNEAQHESILNRPGLGNIVFKRSSVWSPEDIDDSKRELGFKMSSD
LFQRHGASEADEAEEDDEEGEKNGLGGDLPWEEEEVEWEEDVVNATPLEVFLQSQHLEEF
LPIFMREQIDLEALLLCSDEDLQNIRMQLGPRKKVLNAINRRKQTLQEPGPLIDTSL
Download sequence
Identical sequences ENSDORP00000008159 ENSDORP00000008159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]