SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008293 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000008293
Domain Number - Region: 441-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000159
Family Classic zinc finger, C2H2 0.052
Further Details:      
 
Domain Number - Region: 1035-1083
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000203
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number - Region: 831-880
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000453
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008293   Gene: ENSDORG00000008840   Transcript: ENSDORT00000008838
Sequence length 1098
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5426:14009:310593:-1 gene:ENSDORG00000008840 transcript:ENSDORT00000008838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARFVPTPPPNRLNYKSEGRLSEQDWQAHFKVPCYGVDPSQLESEEAEVDVRERETQRDRE
PKRARDLTLRDSCIDNSMQFGTRTTTAEPGFMGTWQNADTNLLFRMSQQAIRCTLVNCTC
ECFQPGKINLRTCDQCKHGWVAHALDKLSTQHLYHPTQVEIVQSNVVFDISSLMLYGTQA
VPVRLKILLDRLFSVLKQEEVLHILHGLGWTLRDYVRGYXXXDAAGKVLDRWAIMSREEE
IITLQQFLRFGETKSIVELMAIQEKEGQAVAVPSSKTDSDIRTFIESNNRTRSPSLLAHL
ENSNPSSIHHFENIPNSLAFLLPFQYINPVSAPLLGLPPNGLLLEQPGLRLREPSLSTQN
EYNESSESEVSPTPYKNDQTPNRNALTSITNVEPKTEPACVSPIQNSAPVSDLTKTEHPK
SSFRIHRMRRMGSASRKGRVFCNACGKTFYDKGTLKIHYNAVHLKIKHRCTIEGCNMVFS
SLRSRNRHSANPNPRLHMPMLRNNRDKDLIRATSGAATPVIASTKSNLTLTSPGRPPMGF
TTPPLDPVLQNPLPSQLVFPGLKTVQPVPPFYRSLLTPGEMVSPPTSLPTSPIIPTSGTI
EQHPPPPSEPVVPAVMMATHEPSVDLAPKKKPRKSSMPVKIEKEIIDTADEFDDEDDDPN
DGGTVVNDMSHDNHCHSQEEMSPGMSVKDFSKHNRTLCISRTEIRRADSMTSEDQEPERD
YENESESSEPKLGEESMEGDEHMHGEVSEKVLMNSERPDENHSEPSHQDVIKVKEEFTDP
TYDMFYMSQYGLYNGGGASMAALHESFASSLNYGSPQKFSPEGDLCSSPDPKICYVCKKS
FKSSYSVKLHYRNVHLKEMHVCTVAGCNAAFPSRRSRDRHSANINLHRKLLTKELDDMGL
DSSQPSLSKDLRDEFLVKIYGAQHPLGLDVREDASSPAGTEDSHLNGYGRGMAEDYMVLD
LSTTSSLQSSSSIHSSRESDAGSDEGILLDDIDGASDSGESAHKAEALALPGSLGAEVSG
SLMFSTLSGSNSGIMCNICHKMYSNKGTLRVHYKTVHLREMHKCKVPGCNMMFSSVRSRN
RHSQNPNLHKNIPFTSID
Download sequence
Identical sequences ENSDORP00000008293 ENSDORP00000008293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]