SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008294 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008294
Domain Number 1 Region: 450-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.9e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 384-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.08e-19
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 3 Region: 361-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000279
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 296-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000803
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000008294
Domain Number - Region: 81-120
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0425
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008294   Gene: ENSDORG00000008839   Transcript: ENSDORT00000008839
Sequence length 570
Comment pep:novel scaffold:dipOrd1:scaffold_12760:7692:12498:1 gene:ENSDORG00000008839 transcript:ENSDORT00000008839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YCSTKPELIFKLEQGDNLWSLNKKNQLLSPNSPEDCHPDILSEKNPENQGKHLSQILFKA
LTTGPEISAKPYDPDINIFPTRVKPYKCDTIGPTYLGLSPLFSHTQCSREKAYEVSLHEK
RLLGSKHCRMNTGMKSFVYSEYREPLNYMEEVNQHQNIQNLRQVFNYNESRQALEKASLK
ISQSTHPKLKYCGFNISVETQRNKSTIIVSQDIPPEDKSRYELNESRNSFSQTTQKTPRT
SFIQKSYQEQQRNHTAVKHLKYGKNLQHNPALLLYERTHTTDKPSDLPCTSSCQETCDVH
LSSHFKLKPHEGNECGQPHSVVLLLIRPQKSHTGDKPYESYESRRVFGKNSCLSKVQTPY
IYKCDSCEKTFKTRSGLKWHQRNHTGDKPFKCNECRKSFIFKSNLILHQRTHTGEKPFIC
GKCGKSFAHRSGLGTHTWERPYQCEVCEKAFKLKSDLSNHHRTHTGEKPYVCDDCGKTFG
SKSVLRKHQKIHTREKPFKCRKPASQKSSLREQKVHTKNIYECKEYRRSQKSELNHKRAR
NCKYSEHNSAQHYQNIRKTRYKFIYFGEGG
Download sequence
Identical sequences ENSDORP00000008294 ENSDORP00000008294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]