SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008316 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008316
Domain Number 1 Region: 130-225
Classification Level Classification E-value
Superfamily Ankyrin repeat 7e-19
Family Ankyrin repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000008316
Domain Number - Region: 63-120
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.0549
Family Pyk2-associated protein beta ARF-GAP domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008316   Gene: ENSDORG00000008863   Transcript: ENSDORT00000008862
Sequence length 757
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3310:19683:69394:-1 gene:ENSDORG00000008863 transcript:ENSDORT00000008862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKRLRSSDVCADCSGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXMVETLYNNGANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRL
PCRDDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQI
LQAELLAVYGADPGTQDSSGKTPVDYARQGGHHELAERLVEIQYELTDRLAFYLCGRKPD
HKNGQHFIIPQMADSSLDLSELAKAAKKKLQSLNNHLFEELAMDVYDEVDRRETDAVWLA
TQNHSTLVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGS
PLSSSKDNVELILKTINNQHSIESQDNDQPDYDSVASDEDTDLETTASKANRQKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQTLQSENSSLRKQAT
TNVYQVQTGSEYPDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPIGEANHPEESRTR
LQPFPAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXSSRKGRQRSMVWPGDCSVPDLAEPHISPMLPSTEDVIRKTEQITKNIQELLRAAQ
ENKHDSYTPCSERIHGAVTEMAVLFPKKPKSDTVRTSLRLLTSSAYRLQSECKKALPGES
GSPTDVQLVTQQVIQCAYDIAKAAKQLVTITTKENNN
Download sequence
Identical sequences ENSDORP00000008316 ENSDORP00000008316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]