SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008372 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008372
Domain Number 1 Region: 72-107
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000157
Family KRAB domain (Kruppel-associated box) 0.0027
Further Details:      
 
Domain Number 2 Region: 195-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000352
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 150-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000507
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008372   Gene: ENSDORG00000008918   Transcript: ENSDORT00000008919
Sequence length 252
Comment pep:novel scaffold:dipOrd1:scaffold_18100:23263:25767:-1 gene:ENSDORG00000008918 transcript:ENSDORT00000008919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFLHLSDTVEPPGEGQEEARMEESAPLSCSVKEEPSAYGQMACPRPRPLAQSPEGCLEHQ
EPASTSCHPPRTQEEWGLLGPSQKELYWDVMLEKYGAVMSLGLQPPGQVMAAESEAGTRG
MEPQHLNKNPSETQEGPAPGPLPRPCSQPTTKPYTCEQCGQSFNWKALFVIHHRTHVGGA
GPERPSQVLREQRCRSYSCEDCGRSFSWKSQLVIHRKSHAGQRRHFCVDCGCGFDWKSHL
VIHRKSHLPQAP
Download sequence
Identical sequences ENSDORP00000008372 ENSDORP00000008372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]