SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008431 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008431
Domain Number 1 Region: 307-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 364-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-25
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 3 Region: 251-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.73e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 195-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.72e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 409-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 157-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.04e-17
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 509-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000254
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 8 Region: 477-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000142
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 1-28
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000392
Family KRAB domain (Kruppel-associated box) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008431   Gene: ENSDORG00000008977   Transcript: ENSDORT00000008978
Sequence length 588
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6473:1054:7719:-1 gene:ENSDORG00000008977 transcript:ENSDORT00000008978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENYGNMASLGFSIPKPELISQLEQGEELWVLDLLGAEEPEVLRTCQTDSEIGTKKELS
ILSQKYSEELKTPEFIFRRSKPNLQAPESQEAQGHEIRQKESGCSAEQNVKKSCLHRRAF
REEQPTEQRPEVCGVSDGHLKPNQSIVRLQGNKIEDRAFKCGICSKAFKYKSDLKRHRRG
HTGEKPYVCGRCGRAFTHSSGLNMHRQVHTGNKPFKCNDCGKTFGLNSHLRLHQRIHTGE
RPFGCNQCGKAFSRSSSLIQHRVIHTGQKPYKCNDCGRAFSQSPQLTQHQRIHTGEKPHA
CTWCGKAFSRSSSLIQHQRIHTGEKPHKCNQCGKAFSQSSSLFLHHRVHTGEKPYVCSEC
GRAFGFNSHLTEHVRIHTGEKPYVCNECGKAFSRSSTLVQHRRVHTGEKPYQCTECGKAF
SQSSQLTLHQRVHTGEKPYECGSCGKAFSRRSTLTQHQRVHTGKIPLGGKCNPAFAHDSS
HPSTRERCGRAFSHGENLVLHWTVHTGWKTLGCNECGKTFSPTQPTMHQKTNAGDKPYKC
QECAKAVSGGSALIQHQVTPGGDKSLLNDGSERYFIHIKKIFQERRFE
Download sequence
Identical sequences ENSDORP00000008431 ENSDORP00000008431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]