SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008462 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008462
Domain Number 1 Region: 31-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000959
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008462   Gene: ENSDORG00000009014   Transcript: ENSDORT00000009013
Sequence length 253
Comment pep:novel scaffold:dipOrd1:scaffold_3809:53704:73351:-1 gene:ENSDORG00000009014 transcript:ENSDORT00000009013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRVAETLRGRAKPRGRAGNTTPAAVNRTGTCAQLQPPPRGTLQVLRGNGTSVGTVLVFH
CPSGHQMVGSGLLTCAWKENIADWSSGTPVCKSVPPHETFGFKVAVIASIVSCAIILLMS
VAFLTCCFLKCVKRSEQQRSNRTAQLWYQLRGEDLETVQAAYLGLKSHNKPGSRSNQAHD
NHSFAIDLSDGIRGLASVTHDVDKDPWTFGPGSSSTGGLSNSPCNPVVVHTVSPGKSLTG
SRSTTRITTRPCT
Download sequence
Identical sequences ENSDORP00000008462 ENSDORP00000008462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]