SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008496 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008496
Domain Number 1 Region: 987-1131
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.31e-39
Family Poly(A) polymerase, PAP, N-terminal domain 0.019
Further Details:      
 
Domain Number 2 Region: 1134-1271
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 9.81e-36
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0059
Further Details:      
 
Domain Number 3 Region: 431-490,535-630
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 3.14e-31
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.042
Further Details:      
 
Domain Number 4 Region: 286-424
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.51e-24
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.069
Further Details:      
 
Domain Number 5 Region: 1431-1463
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000012
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 
Domain Number 6 Region: 1331-1360
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000907
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Domain Number 7 Region: 951-975
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000523
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000008496
Domain Number - Region: 236-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000744
Family HkH motif-containing C2H2 finger 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008496   Gene: ENSDORG00000009046   Transcript: ENSDORT00000009048
Sequence length 1485
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_758:1274:69106:-1 gene:ENSDORG00000009046 transcript:ENSDORT00000009048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDATKSYFVKRTKDRGTIDDEDFRRGHPQQDYLIMDDYAKGHSSKMEKSLPKKKITPGN
YGNTPRKGPYAVSSNPYAFKNPIYSQPAWMNDNHKDQSKRWLSDELTGSSDSWREFKIAP
RIPIMSRPRKDSFQESDERYRWQEGRGCRTVRPLFHKDLTSLDTMSELEAGSPENKKQRP
RPRKPRRTRNEENEQDGELEGPVIDESVLSTKELLGLQQAEERLKRDCIDRLKRRPRNCP
TAKYTCKLCDVLIESIAFAHKHIKEKRHKKNIKEKQEEELLTTLPPPTPSQINSVGIAIE
KVVQEFGLHNENLEQRIEIKSTMGRVFHHKLPDCSLRLYGSSCSRLGFKNSDVNIDIEFP
ATMSQPDVLLLVQECLKNSDCFIDVDADFHARVPVVVCREKQSGLLCKVSAGNENACLTT
KHLTTLRKLEPKLLPLVIAFRYWAKCSIDQPEEGGSPYVFALMVIFFLQQRKEPLLPVYL
GSWIEGFSLNKLGNFNLKDIENDFVVWEYTDNATGDINTAKEETPKEMPVKRGQVPLMFD
TKHQPSVPVGQLWVELLRFYALEFNLADLVISIRVKESISRESKDWPKKRIAIEDPYSVK
RNVARTLNNQPVFQYILHCLRTTYKYFALPHKVTKSSLPKPLSPNTCISEHSTETTNHDP
DIQAKDDKLKNSDLAQGPGATTISTSNTCKAQPLTLKETTENFKSPPVNNKENVQFSAHL
ENSGLKQTDVNSESHKHHQKTGSKNERKKIRRTSKHLLTTNDQNLCSNKHGDLLACNSTH
NCETDWDVEDIENLKTEEGGGFVPLDDNADFDRKHIKSTNDREDFINHFDPSVQGQASEI
IHFNEEEEEEEEPRLIINPKEEGDGIGNEDELDNTYTGSGDEDALSEEDDELLDPSKYED
LKDCGKHVDGTLLIELNNISLREENICEENSSVDLSDFFYEFSKLIFTKGKSPTVVCSLC
KREGHLKKDCPEDFKRIQLEPLPPLTPKFSNILDQVCIQCYKDFSPTVLEDQAREHIRQN
LESFIKQDFPGTKLSLFGSSKNGFGFKQSDLDVCMTINGHETAEGLDCVRTIEELARVLR
KHSGLRNILPITTAKVPIVKFFHLRSGLEVDISLYNTLALHNTRLLSAYSAIDPRVKYLC
YTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRNPPVIPVLQEIYKGEKKPEIFVDG
WNIYFFDQIDELPNYWPEYGKNTESVGQLWLGLLRFYTEDFDFKEHVISIRRKSLLTTFK
KQWTSKYIVIEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEY
FFDPDVLTEGELAPNDRCCRICGKIGHFMKDCPMKVRRRRDQEDALNQRHPDNKEKRSKE
DKEIQNKYTEREVSTKEDKLMQCTAQKAKPMRAAVDLGREKIVRPSVEKWKRQDDKDLRE
KRCFICGREGHIKKECPQFKGSSGSLSSKYMTQGKASAKRTQQES
Download sequence
Identical sequences ENSDORP00000008496 ENSDORP00000008496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]