SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008505 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008505
Domain Number 1 Region: 345-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000757
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 24-111
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000549
Family BTB/POZ domain 0.0041
Further Details:      
 
Domain Number 3 Region: 387-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000379
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008505   Gene: ENSDORG00000009058   Transcript: ENSDORT00000009057
Sequence length 461
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_685:7275:9170:1 gene:ENSDORG00000009058 transcript:ENSDORT00000009057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPPPRLLSPYGSDRLVSLAAQLRPALCDTLIIVGGHEFPAHSLVLAGVSQQLGRRGRW
ALAEGIRPSTFAQLLNFVYGESVELQPGELGLLEDAARALGVQALEEACRRARRDPAEDV
QEAGLKKGGQGSLGKEQKPEDFRPGGREEKILHKPPREHQEVAGMTQEAGELRPKGKLSQ
ASVGQGEAVGRQAVVMQVTESPEGSEEKVREFPGSLPQPSSLQSHGTPRPWWVETPWLGE
GQAAVWSILMWPPRCGAPFSPSTSGTGIWQAWLPDQRIPLTLISPKGLCSKNQVGSSNPT
PGSLPQGPMEMGESGWGYGGVLATCVGHVGTSGRLSRRPPTAGSRPYSCSVCGKRFSLKH
QMETHYRVHTGEKPFSCSLCPQRSRDFSAMTKHLRTHGAAPYRCPLCGAGCPSLASMQAH
MRGHSPSQLPPGWTIRSTFLYSSSSSKPTRASSSPGSSSIG
Download sequence
Identical sequences ENSDORP00000008505 ENSDORP00000008505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]