SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Dipodomys ordii 69_1 > ENSDORP00000008616

Domain assignment for ENSDORP00000008616 from Dipodomys ordii 69_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSDORP00000008616
Domain Number 1 Region: 153-224
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.17e-17
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 2 Region: 769-831
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-16
Family Complement control module/SCR domain 0.00047
Further Details:      
 
Domain Number 3 Region: 525-594
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.78e-16
Family Complement control module/SCR domain 0.00044
Further Details:      
 
Domain Number 4 Region: 410-472
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.14e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 274-343
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000108
Family Complement control module/SCR domain 0.00055
Further Details:      
 
Domain Number 6 Region: 901-966
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000778
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 7 Region: 606-664
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000431
Family Complement control module/SCR domain 0.00068
Further Details:      
 
Domain Number 8 Region: 349-419
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000542
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 9 Region: 955-1019
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000306
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 10 Region: 214-285
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000114
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 11 Region: 837-897
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000012
Family Complement control module/SCR domain 0.00079
Further Details:      
 
Domain Number 12 Region: 661-721
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000133
Family Complement control module/SCR domain 0.00088
Further Details:      
 
Domain Number 13 Region: 88-147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000306
Family Complement control module/SCR domain 0.00014
Further Details:      
 
Domain Number 14 Region: 21-82
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000876
Family Complement control module/SCR domain 0.00025
Further Details:      
 
Domain Number 15 Region: 733-780
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000032
Family Complement control module/SCR domain 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000008616
Domain Number - Region: 483-536
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000208
Family Complement control module/SCR domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008616   Gene: ENSDORG00000009173   Transcript: ENSDORT00000009173
Sequence length 1084
Comment pep:novel scaffold:dipOrd1:scaffold_2552:8768:40436:1 gene:ENSDORG00000009173 transcript:ENSDORT00000009173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
MGATTLLWVSLTVFAPGVLGISCDPPPPIKHGGKSLVSDPISGTVVIYSCPNVFRLIGEK
ALFCISKDNVTGVWDKAAPTCEYFNRNARCTEPKVPGGYKKEGSRTSYTHGRSVTFACHP
NFTMKGNKTVWCRANSTWGPTPVPTCESDFPLECPPLAEIRHGYHTGQKAGHYAPGSSVT
YSCQPGYLLDGQKTIECLSSGDWSSDSPTCKEAQCDPLGPFPNGKVKAPASPRFGVTASF
TCNEGYWLKGQPSSQCVIVGQKAVWTKQPVCEEILCPAPSAILNGRHTGSSSVRFPYGSR
VTYTCDPGPEGGIEFVLVGESTIHCTAGSLMSGSWSAPAPRCELSTSAIQCSHPQILRGL
TLSVQKEQYSYNETVVFACESDFTMKGSNKVRCNAQGIWEPPAPVCEKACQAPPEILNGQ
KEEKHMVRFDPGTSVNYSCDPGYVLVGEESIHCTPEGTWSPAVPQCKVAECKPIGPQLFT
KPKDRFIRPAVNASCGEGSRLSGSAYQLCQGTVPWFVEIRLCKEITCSPPPVIYNGIHTG
STSEDVPYGTTVTYTCNPGPEKGVQFDLIGEGTIRCTSKDGVRGSWSSPAPLCRLRLPVV
QCSKVIIDNGYTTSVKNASYVYNDSITIKCNPGYILNGSSQIRCKANNTWDPHIPTCEKG
CQVPSEIHHGRHTGGNMILFVSGMSVDYTCDPGYMLVGNKSIHCMPSGQWSPAPCEEGCE
PVQLPRGSPVKLVNTSCQDGYQMTGYTHEKCQDTKNGVWFQKIPVCTVIHCQPPPMIANG
KYRSTVEEPFLYGSKVFYECDPGFYLLGEKNLQCSKDSKGQGSWSGPLPQCLRSPVTHCP
NPEVKHGYKLNKTRATYSHNDIVHVACNPGFLMNGSHLIRCHTDNTWVPGIPTCIKMAFL
CQSPSTIFKGNHTGGNTAQFSPGMSIRYSCDQGYLLVGEALRVCTHEGIWSQPAPYCKEV
NCSFPEEINGIQKGLEPGRVYQYGAIVTLECEDGYTLDGSPQSQCQGDHQWNPPLAVCRS
RSLIPILGGICAGSALLIVLAVIALFMIIKYRGRHYYTNAKPKEGVLHLETRDGYSVDPY
NPAS
Download sequence
Identical sequences ENSDORP00000008616 ENSDORP00000008616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.