SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008636 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000008636
Domain Number - Region: 26-78,143-167
Classification Level Classification E-value
Superfamily BRCT domain 0.000523
Family DNA-repair protein XRCC1 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008636   Gene: ENSDORG00000009196   Transcript: ENSDORT00000009194
Sequence length 655
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1441:144180:166337:1 gene:ENSDORG00000009196 transcript:ENSDORT00000009194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLQVKNEKNRLSLNSLKPESRPEKSKYKPFWGKIFYLDLPSVTISEKLQKDIKDLGGRVE
EFLSKDISYLISSKKEAKYAQTLGRISPVPSPESAYTAETTSPHPSHDGSSFKSPDTVYL
SRGKLLVEKAIKDHDFIPSNSILSNALSWGVKILHIDDIRHYIEQRKKELCLLKKPSTSV
RDVGKRVVVGTQKTRRGRLKKPFIKVEDMDQLYRPFYLQFTNMPFINYSTQKPCSPFDVD
KASSIQKQTQVKLRIQMDGHKYGGSSVQLQLKEKKKKGYCECCLQKYEDLETHLQSEQHR
SFSQSNQYEIVDDIVSKLNFDFVEYERDIPKKKRIKYSFRSLSSVSTNFLKKTEPKEKCE
LQYICQKCQENNGKVMKQNILYAETQEPEQKLVFISESVPCLSNELRGFREKRINECSVL
NATENNIKQNFTHLPPYKNKQEIIFNTSEHKLIVHENDLEDHCPSRLHPYVQVSHPSTDN
SMLQPKGKSNTHLFPSKDLKEKDLHITNGHGYDLSTMNISQEHLRIKTKSLCCSPLGEPS
ECGSNRTDDLPSGRIHQKVRILLGRNKKENLEPNAELDEKTEFLIAQEAKRICTSPVQSL
LDLFQTSGEKSEFCGFTSYTENSGICEMLNIWEKESSDTLLSTFFSSPSTSFIGF
Download sequence
Identical sequences ENSDORP00000008636 ENSDORP00000008636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]